0% found this document useful (0 votes)
58 views

Mus Musculus Transformation Related Protein 73 (Trp73), Transcript Variant 3, mRNA

This document provides information on transcript variant 3 of the mouse Trp73 gene, including its mRNA sequence, exons, protein product, and references. Specifically, it notes that variant 3 lacks some 5' exons and two internal exons compared to variant 1, but has an alternate first exon. The resulting isoform lacks an internal segment and different N-terminus compared to isoform a. Several references discuss roles for this gene in spermatogenesis, fertility, and the nervous system.

Uploaded by

Eeeeeeeee
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOC, PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
58 views

Mus Musculus Transformation Related Protein 73 (Trp73), Transcript Variant 3, mRNA

This document provides information on transcript variant 3 of the mouse Trp73 gene, including its mRNA sequence, exons, protein product, and references. Specifically, it notes that variant 3 lacks some 5' exons and two internal exons compared to variant 1, but has an alternate first exon. The resulting isoform lacks an internal segment and different N-terminus compared to isoform a. Several references discuss roles for this gene in spermatogenesis, fertility, and the nervous system.

Uploaded by

Eeeeeeeee
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOC, PDF, TXT or read online on Scribd
You are on page 1/ 7

Mus musculus transformation related protein 73 (Trp73),

transcript variant 3, mRNA


NCBI Reference Sequence: NM_001126331.1
FASTA Graphics
Go to:

LOCUS NM_001126331 4468 bp mRNA linear ROD 15-FEB-2015


DEFINITION Mus musculus transformation related protein 73 (Trp73), transcript
variant 3, mRNA.
ACCESSION NM_001126331
VERSION NM_001126331.1 GI:187827011
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 4468)
AUTHORS Costanzo A, Pediconi N, Narcisi A, Guerrieri F, Belloni L, Fausti
F, Botti E and Levrero M.
TITLE TP63 and TP73 in cancer, an unresolved 'family' puzzle of
complexity, redundancy and hierarchy
JOURNAL FEBS Lett. 588 (16), 2590-2599 (2014)
PUBMED 24983500
REFERENCE 2 (bases 1 to 4468)
AUTHORS Holembowski L, Kramer D, Riedel D, Sordella R, Nemajerova A,
Dobbelstein M and Moll UM.
TITLE TAp73 is essential for germ cell adhesion and maturation in testis
JOURNAL J. Cell Biol. 204 (7), 1173-1190 (2014)
PUBMED 24662569
REMARK GeneRIF: TAp73 ensures fertility by enabling sperm maturation.
REFERENCE 3 (bases 1 to 4468)
AUTHORS Inoue S, Tomasini R, Rufini A, Elia AJ, Agostini M, Amelio I,
Cescon D, Dinsdale D, Zhou L, Harris IS, Lac S, Silvester J, Li WY,
Sasaki M, Haight J, Brustle A, Wakeham A, McKerlie C, Jurisicova A,
Melino G and Mak TW.
TITLE TAp73 is required for spermatogenesis and the maintenance of male
fertility
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 111 (5), 1843-1848 (2014)
PUBMED 24449892
REMARK GeneRIF: TAp73 has a unique role in spermatogenesis.
REFERENCE 4 (bases 1 to 4468)
AUTHORS Dixit R, Wilkinson G, Cancino GI, Shaker T, Adnani L, Li S, Dennis
D, Kurrasch D, Chan JA, Olson EC, Kaplan DR, Zimmer C and
Schuurmans C.
TITLE Neurog1 and Neurog2 control two waves of neuronal differentiation
in the piriform cortex
JOURNAL J. Neurosci. 34 (2), 539-553 (2014)
PUBMED 24403153
REFERENCE 5 (bases 1 to 4468)
AUTHORS Niklison-Chirou MV, Steinert JR, Agostini M, Knight RA, Dinsdale D,
Cattaneo A, Mak TW and Melino G.
TITLE TAp73 knockout mice show morphological and functional nervous
system defects associated with loss of p75 neurotrophin receptor
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (47), 18952-18957 (2013)
PUBMED 24190996
REMARK GeneRIF: TAp73 is a transcriptional activator of the p75
neurotrophin receptor.
REFERENCE 6 (bases 1 to 4468)
AUTHORS Pozniak CD, Radinovic S, Yang A, McKeon F, Kaplan DR and Miller FD.
TITLE An anti-apoptotic role for the p53 family member, p73, during
developmental neuron death
JOURNAL Science 289 (5477), 304-306 (2000)
PUBMED 10894779
REFERENCE 7 (bases 1 to 4468)
AUTHORS Lohrum MA and Vousden KH.
TITLE Regulation and function of the p53-related proteins: same family,
different rules
JOURNAL Trends Cell Biol. 10 (5), 197-202 (2000)
PUBMED 10754563
REMARK Review article
REFERENCE 8 (bases 1 to 4468)
AUTHORS Yang A, Walker N, Bronson R, Kaghad M, Oosterwegel M, Bonnin J,
Vagner C, Bonnet H, Dikkes P, Sharpe A, McKeon F and Caput D.
TITLE p73-deficient mice have neurological, pheromonal and inflammatory
defects but lack spontaneous tumours
JOURNAL Nature 404 (6773), 99-103 (2000)
PUBMED 10716451
REFERENCE 9 (bases 1 to 4468)
AUTHORS Herranz M, Santos J, Salido E, Fernandez-Piqueras J and Serrano M.
TITLE Mouse p73 gene maps to the distal part of chromosome 4 and might be
involved in the progression of gamma-radiation-induced T-cell
lymphomas
JOURNAL Cancer Res. 59 (9), 2068-2071 (1999)
PUBMED 10232589
REFERENCE 10 (bases 1 to 4468)
AUTHORS Kaelin WG Jr.
TITLE The emerging p53 gene family
JOURNAL J. Natl. Cancer Inst. 91 (7), 594-598 (1999)
PUBMED 10203277
REMARK Review article
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK139633.1, AK017412.1 and
AK014503.1.

Summary: This gene encodes tumor protein p73, which is a member of


the p53 family of transcription factors involved in cellular
responses to stress and development. The family members include
p53, p63, and p73 and have high sequence similarity to one another,
which allows p63 and p73 to transactivate p53-responsive genes
causing cell cycle arrest and apoptosis. The family members can
interact with each other in many ways involving direct or indirect
protein interactions, resulting in regulation of the same target
gene promoters or regulation of each other's promoters. The p73
protein is expressed at very low levels in normal tissues and is
differentially expressed in a number of tumors. The p73 gene
expresses at least 35 mRNA variants due to the use of alternate
promoters, alternate translation initiation sites, and multiple
splice variations. Theoretically this can account for 29 different
p73 isoforms; however, the biological validity and the full-length
nature of most variants have not been determined. [provided by
RefSeq, Jul 2008].

Transcript Variant: This variant (3) is an alternate promoter


product; it lacks a few of 5' exons and two internal exons in the
3' region, but has an alternate 5' exon, as compared to variant 1.
The resulting isoform c, also known as DNp73zeta, has a shorter and
different N-terminus and lacks an internal segment in the
C-terminal region, as compared to isoform a.

Publication Note: This RefSeq record includes a subset of the


publications that are available for this gene. Please see the Gene
record to access additional publications.

##Evidence-Data-START##
Transcript exon combination :: AK139633.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
SAMN00849374, SAMN00849375
[ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-496 AK139633.1 2-497
497-1296 AK017412.1 28-827
1297-2205 AK139633.1 1298-2206
2206-4468 AK014503.1 1473-3735
FEATURES Location/Qualifiers
source 1..4468
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="4"
/map="4 83.79 cM"
gene 1..4468
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/note="transformation related protein 73"
/db_xref="GeneID:22062"
/db_xref="MGI:MGI:1336991"
exon 1..280
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
misc_feature 47..49
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/note="upstream in-frame stop codon"
CDS 242..1726
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/note="isoform c is encoded by transcript variant 3"
/codon_start=1
/product="tumor protein p73 isoform c"
/protein_id="NP_001119803.1"
/db_xref="GI:187827012"
/db_xref="CCDS:CCDS51396.1"
/db_xref="GeneID:22062"
/db_xref="MGI:MGI:1336991"
/translation="MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASA
PTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKL
YCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDIVKRCPNHELGRDFNEGQSA
PASHLIRVEGNNLAQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMN
RRPILVIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESTTKNGAA
SKRAFKQSPPAIPALGTNVKKRRHGDEDMFYMHVRGRENFEILMKVKESLELMELVPQ
PLVDSYRQQQQQQLLQRPFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKVPD
QYRMTIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTI
TIPNRGGAGAVTGPDEWADFGFDLPDCKSRKQPIKEEFTETESH"
exon 281..523
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 524..710
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 711..826
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 827..936
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 937..1079
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 1080..1168
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 1169..1296
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 1297..1390
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
exon 1391..4468
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/inference="alignment:Splign:1.39.8"
STS 3825..4186
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
/db_xref="UniSTS:235114"
regulatory 4444..4449
/regulatory_class="polyA_signal_sequence"
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
polyA_site 4464
/gene="Trp73"
/gene_synonym="deltaNp73; p73; TAp73; Tp73"
ORIGIN
1 gttgttggat gcagccagtt gacagaaatg agggagatgg gcagggtgag aatgccaact
61 ctcagtccgc acgcctctga gcatcctccg ctcctgcctt cctagccaca gagcctcaac
121 ccctcagtcc accccaccgg gcagccacca gtctacccct accccaccta gccacccaga
181 cccatgcctc gtcccgcggc acaccagctc ctcagcgtgt gcagaccccc acgagcctac
241 catgctttac gtcggtgacc ccatgagaca cctcgccacg gcccagttca atttgctcag
301 cagtgccatg gaccagatgg gcagccgtgc ggccccggcg agcccctaca ccccggagca
361 cgccgccagc gcgcccaccc actcgcccta cgcgcagccc agctccacct tcgacaccat
421 gtctccggcg cctgtcatcc cttccaatac cgactacccc ggcccccacc acttcgaggt
481 caccttccag cagtcgagca ctgccaagtc ggccacctgg acatactccc cactcttgaa
541 gaagttgtac tgtcagattg ctaagacatg ccccatccag atcaaagtgt ccacaccacc
601 acccccgggc acggccatcc gggccatgcc tgtctacaag aaggcagagc atgtgaccga
661 cattgttaag cgctgcccca accacgagct tggaagggac ttcaatgaag gacagtctgc
721 cccggctagc cacctcatcc gtgtagaagg caacaacctc gcccagtacg tggatgaccc
781 tgtcaccgga aggcagagtg tggttgtgcc gtatgaaccc ccacaggtgg gaacagaatt
841 taccaccatc ctgtacaact tcatgtgtaa cagcagctgt gtggggggca tgaatcggag
901 gcccatcctt gtcatcatca ccctggagac ccgggatgga caggtcctgg gccgccggtc
961 tttcgagggt cgcatctgtg cctgtcctgg ccgtgaccgc aaagctgatg aagaccatta
1021 ccgggagcaa caggctctga atgaaagtac caccaaaaat ggagctgcca gcaaacgtgc
1081 attcaagcag agcccccctg ccatccctgc cctgggtacc aacgtgaaga agagacgcca
1141 cggggacgag gacatgttct acatgcacgt gcgaggccgg gagaactttg agatcttgat
1201 gaaagtcaag gagagcctag aactgatgga gcttgtgccc cagcctttgg ttgactccta
1261 tcgacagcag cagcagcagc agctcctaca gaggcctttt ttgacagggt tggggtgtcc
1321 aaactgcatc gagtgcttca cttcccaagg gttgcagagc atctaccacc tgcagaacct
1381 taccatcgag gaccttgggg ctctgaaggt ccctgaccag taccgtatga ccatctggag
1441 gggcctacag gacctgaagc agagccatga ctgcggccag caactgctac gctccagcag
1501 caacgcggcc accatctcca tcggcggctc tggcgagctg cagcggcagc gggtcatgga
1561 agccgtgcat ttccgtgtgc gccacaccat cacgatcccc aaccgtggag gcgcaggtgc
1621 ggtgacaggt cccgacgagt gggcggactt tggctttgac ctgcctgact gcaagtcccg
1681 taagcagccc atcaaagagg agttcacaga gacagagagc cactgaggaa cgtaccttct
1741 tctcctgtcc ttcctctgtg agaaactgct cttggaagtg ggacctgttg gctgtgccca
1801 cagaaaccag caaggacctt ctgccggatg ccattcctga agggaagtcg ctcatgaact
1861 aactccctct tggaaacttc tggaactgcc cttagctaca tatacacaag ggcaggtggt
1921 gagccaagtg ctgagacagg gagctgtccc tttgtgggtg ggtatgcagc acccatttgc
1981 ttctcccgtt ctctattgag gactctgcca cctccaggac agagcagcat ccttcacttg
2041 ctcaccctct gccacaaagt attccaacat cttctgttcc tgctaaccat gcacagccca
2101 gcctctgtgt catcagcgct tacgtacagg tcgattccac tgtgtcttga aagtgaattc
2161 agggccagag acatcttctg caggatgtgt ggacagatct gtccctaatg taggtcattc
2221 tgccgttacc ccttgtctcc cgagtcttga ttgctggggt cagggaagac tgtggcagag
2281 caggggaagc cgctggccct ccgcctctag ccagcaccct gaacatgctg gctgtagcag
2341 cctctaggga cctctctggt cagacaaagg gacagaatga gtctcagact accgaaaatt
2401 gaattgtcaa tatttgataa aaggttactc tttctacttg gtggggtcag cttgcttttt
2461 cccccctctc tgactctctc agcattcctt tctgagatca gcctagtgtg tccacacgta
2521 cttctcaaca agtctaaaac gccgagcatc aatccaggaa gggtccttac ctgttaccag
2581 gatggttgga agggaaagag actcagagag agcatagccg tgggagtgca ggtcagacag
2641 accccagctg tgaggaacat ctgttctcac taagtgctca gagtctgggc tctgtgcctg
2701 agtgctagcc catcctcgtg gcctggaact ggagtggctg ctgggggccc tggtcttcat
2761 gattcatccc caaagagtca gtggctagag aaacagctcc tgcatgcatt cagccaatgg
2821 ggccctgtac ctgccagaag ctttgtgaac ttctgcaatg agagccccca gcagtccctg
2881 ccaggagtgg agaagcacag aggagcccct gccaacagta aagcccaaca tctgccgagt
2941 cactttggag ccatcctctt taggcttggc tttcattagc aaggcccaac agaggcagtg
3001 acgtccgtgg gatagcctca gagtcagcac taccagggct ggcgtcatat cagggctgcc
3061 tcctcgaagc ccagggacaa tgttgccaat cttagcaatc ttagcaagct ctgcaaactt
3121 aggtggttac cacccatgct atgcttcatg aatctctgag gggcaggatt tgggtgcact
3181 tagggtaggt gcaggcatca cattgtcaga gaccagtgct gaccatacag gcctttccaa
3241 cttgacagat gttgacagct taggctctgg gggggtgggg ggttcctgca cccagatggg
3301 ccgttaacag ctgcagcatc aggcttgctt cttgggtgta ggttgtggcc ctcccagtga
3361 gtggtaacac acttcacaaa gcctgaggtt gactacacac ttcttgttgc tgctcagatg
3421 aggaagctga ggctagacag actgagtgcc ctgcctcggg catcagctca ttgcagaagt
3481 gggtgttcac tcctgaggta catgctgccc catgctacct cagaaactag gcagcacatt
3541 ctcactccta ggcctgtgaa ccccactgag atgcgcttgc gttctgggat ctcacataag
3601 tatgtctcag gcattgtcca ggagggacca tcctaagcgc cccaccacat gctcctggga
3661 aggaggagtg gttaggagga gtggttgtca ccaggcatct gaggagggaa gagcccccct
3721 ccagcaagga cccagggctt gtgtctccct agaccctgcc tcaagtgcca aagctgtctc
3781 gtgagcttcc aggatcctga caggcctgga gggaactgca aagggccatc tgccaggaaa
3841 taaacgtcac agaggcaatg cttgcagtgc ctgagaagct ctccaggaac cagcctttgg
3901 gtctgaacca aactttgttc tacaaaacac agaaagcaag agaaagcaaa tcttccagcc
3961 accaactttc ccaggagcac tggagtacta gtttggaaac aagtttgggg gtgccctgga
4021 agacatctgt tgagcaaggg caggttgagc agggctgtaa aagcaggcca ctccagcctc
4081 agtctgtatg gtcccatcca gctttgtgca tccaattaac agcagctccc atgtcccttc
4141 ctggccttgc ttaccgtgcc tgacagctct accttgggct gctttgagct tgtgagttcg
4201 cagaaccagc acccctacgc aagaatcctg caagggtcaa aagttgccac ttagttgcat
4261 ttcagatggg agacaaaaac caaaactaaa ttgtccatgt ttcaatgtga tgaaatgctt
4321 ctccaagcag tattgatgga tacagtctag tgactctatt aactgttttg ggtgatgtca
4381 ttttagaaaa atgtgttatt ttttttagct gtgtttcggt gggaattttt gtttttgtaa
4441 tataataaaa atcacatgtt cccatggt
//

You might also like