0% found this document useful (0 votes)
287 views136 pages

Protein Purification Protocols Guide

This document provides protocols and tips for purifying proteins in one day. It details general protein purification procedures including preparing equipment and reagents, chromatography systems, and chromatographic columns. Specific chromatographic techniques are described such as ion exchange chromatography, hydrophobic interaction chromatography, gel filtration, and affinity chromatography. Common strategies for developing protein purification protocols are discussed. Finally, example protein purification show cases are provided applying the techniques to various target proteins.

Uploaded by

João Santos
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
287 views136 pages

Protein Purification Protocols Guide

This document provides protocols and tips for purifying proteins in one day. It details general protein purification procedures including preparing equipment and reagents, chromatography systems, and chromatographic columns. Specific chromatographic techniques are described such as ion exchange chromatography, hydrophobic interaction chromatography, gel filtration, and affinity chromatography. Common strategies for developing protein purification protocols are discussed. Finally, example protein purification show cases are provided applying the techniques to various target proteins.

Uploaded by

João Santos
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

Department of

Molecular Biology &


Biotechnology

Protocols and tips


in protein purification
or
How to purify protein in one day

Second edition
2018
2
Contents
I. Introduction 7
II. General sequence of protein purification procedures 9
Preparation of equipment and reagents 9
Preparation and use of stock solutions 10
Chromatography system 11
Preparation of chromatographic columns 13
Preparation of crude extract (cell free extract or
soluble proteins fraction) 17
Pre chromatographic steps 18
Chromatographic steps 18
Sequence of operations during IEC and HIC 18
Ion exchange chromatography (IEC) 19
Hydrophobic interaction chromatography (HIC) 21
Gel filtration (SEC) 22
Affinity chromatography 24
Purification of His-tagged proteins 25
Purification of GST-tagged proteins 26
Purification of MBP-tagged proteins 26
Low affinity chromatography 26

III. “Common sense” strategy in protein purification 27


General principles and tips in “common sense” strategy 27
Algorithm for development of purification protocol for
soluble over expressed protein 29
Brief scheme of purification of soluble protein 36
Timing for refined purification protocol of soluble over -expressed protein 37
DNA-binding proteins 38

IV. Protocols 41
1. Preparation of the stock solutions 41
2. Quick and effective cell disruption and preparation of the cell free extract 42
3. Protamin sulphate (PS) treatment 43
4. Analytical ammonium sulphate cut (AM cut) 43
5. Preparative ammonium sulphate cut 43
6. Precipitation of proteins by ammonium sulphate 44
7. Recovery of protein from the ammonium sulphate precipitate 44
8. Analysis of solubility of expression 45
9. Analysis of expression for low expressed His tagged protein 46
10. Bio-Rad protein assay Sveta’s easy protocol 47
11. Protocol for accurate determination of concentration of pure protein 47
12. Calibration plot for gel filtration column 48
13. Ni-chelating cartridges : cleaning and recharging 48
14. SDS PAGE Sveta’s easy protocol 49
15. DTNB reaction 50
16. Refolding protocol 50

3
V. Charts and Tables 51
Ammonium sulphate –Sugar refractometer 53
NaCl-Sugar refractometer 54
Calibration plot for Hi-load Superdex 200 column 55
Calibration plot at various salt concentrations for Superdex200 GL column 56
Ammonium sulphate table 57
Properties of amino acids 58

VI. Appendix 1 59
[Link] of protein concentration 59
[Link] to concentrate proteins 64
[Link] to store proteins 67
[Link] to estimate purity of a protein preparation 68

VII. Appendix 2 69
1. Prepare your solutions right! 69
2. Gel filtration 70
Separation by molecule’s size 70
Calibration plot 71
Main reasons for “abnormal” mobility of some proteins during 72
gel filtration
3. Time saving tips 73
4. Golden rules in protein purification 74

VIII. Show cases 75

1. Two step purification protocol and a lesson to learn (BPSL 1549 (BLF1)) 75
2. It is easy with the coloured proteins! 79
Single-domain haemoglobin cgb from Campylobacter jejuni 79
Flavohemoprotein HMP from Escherichia coli 81
3. Almost typical three step purification (Glutamate Dehydrogenase from 85
Clostridium symbiosum)
4. Monitoring purification by enzyme activity (Glutamate Dehydrogenase 88
from Clostridium symbiosum)
5. Power and failure of dye pseudo affinity chromatography 91
Phenylalanine Dehydrogenase from Nocardia sp. 91
Glutamate Dehydrogenase from Clostridium symbiosum 97
6. DNA binding proteins 102
Typical Heparin protocol: RuvC from phage bIL67 102
Playing with solubility: LrpC from Bacillus subtilis 104
Heparin and solubility: FrmR from Escherichia coli 105
Real power of Heparin: Human FEN 108
In need of nuclease treatment: SfsA 111
7. Tagged proteins 116
Proper use of a His-tag: Human protein PARP1 expressed in [Link] 116
Removable tag: SAG19 118
Cleaver use of tag: TssA 121
8. Special cases 124
Phosphoglycerate Kinase (PGK) from Escherichia coli 124
Low affinity chromatography: BPSL1958 127
BacM from Myxococcus Xanthus 130
Perfect purity: IGPD from Arabidopsis thaliana 134

4
Abbreviations

AA acrylamide
APMSF 4-Amidinobenzylsulfonyl fluoride hydrochloride
AS ammonium sulphate
CBV column bed volume
CE crude extract
CFE cell free extract
CM carboxymethyl
DEAE diethylaminoethyl
DTNB Dithionitrobenzole
DTT dithiothreitol
EDTA ethylenediaminetetraacetic acid
FF fast flow
HEPES N-(2-hydroxyethyl)piperazine-N'-(2-ethanesulfonic acid)
HIC hydrophobic interaction chromatography
IEC ion exchange chromatography
MES 2-morpholinoethanesulfonic acid
MW molecular weight
MWCO molecular weight cut off
PBS phosphate saline buffer
PS protamine sulphate
PSA ammonium persulphate
PAGE polyacrylamide gel electrophoresis
Q quaternary ammonium
S methyl sulphonate
SDS sodium dodecyl sulphate
SEC size exclusion chromatography or gel filtration
SP sulphopropyl
TEMED N,N,N',N' tetramethylethylenediamine
TP target protein
UV ultraviolet

Contact details
Dr. Svetlana Sedelnikova
Department of Molecular Biology and Biotechnology
The University of Sheffield
Sheffield S10 2TN
Please, contact me by e-mail [Link]@[Link]
All your comments and questions are very welcome

5
With greatest respect and gratitude to my teachers
Prof. Alexander Sergeevich Spirin and
Prof. Marina Borisovna Garber
and people of Institute of Protein Research, Pushchino

and also to my employers Prof. David W. Rice


and Department of Molecular Biology and Biotechnology
of the University of Sheffield

6
I. Introduction
Why do we need to purify protein in one day?
After 25 years and 360 proteins it has become clear to me that for some proteins
even one extra day under conditions normally used for protein purification can
detrimentally affect their activity and crystallisation ability. Whilst the majority of
proteins can survive long purification and can be kept and stored at 4ºC for days
and even weeks with little loss in activity, it does them no harm to be purified in
one day either. To achieve the goal of complete protein purification in one day you
should move fast and choose appropriate protocols, avoiding long procedures such
as dialysis, long centrifugations and slow chromatography. Below are some
protocols and tips which help me to achieve this goal.

My approach is based on classical combination of ion-exchange, hydrophobic and


size-exclusion chromatography for natively (no tags) over-expressed proteins.
Nowadays the high throughput approach dictates increasing use of tags in protein
purification and sometimes classical methods are considered to be defunct. This is
not the case. The most justified use of tags is for difficult expressions, such as
expression of eukaryotic proteins in [Link], expression of the domains of the
proteins, toxic proteins, in the cases when tags help polypeptide chains to fold, in
the cases when correct fold occurs only occasionally and so expression yield is
hardly detectable. In such the cases tagged proteins often cannot be purified to the
desirable purity by using just one tag affinity chromatography, so more
purification steps are required anyway.

We also have to remember that tag as well as being often useful in some cases it
may be an obstacle that prevents correct proteins folding. I consider the recent
trend to do all expressions in a tagged form is misleading . For most of enzymes
and similar cytoplasmic proteins the chance to be successfully expressed is greater
in the absence of the tag. My recent experience also revealed that if the fusion
protein or the tag has to be removed from the target protein you may face a great
problem either with protease underperforming or unspecific proteolysis leading to
damage of the target protein.
In this second edition I have included my recent experience with purification of
the tagged proteins.

Please note that this brochure is not a complete guide to protein purification and
you should still read serious books on the theory of chromatography to become
familiar with the subject.

7
SDS-PAGE equipment

8
II. General sequence
of protein purification procedures

Preparation of equipment and reagents


For protein purification you need the equipment and reagents listed below:

 Sonicator or French Press

 Centrifuge, medium speed (30-70Kg, e.g. J-20 or Avanti J-25)

 Appropriate centrifugation tubes

 Chromatographic system comprising of, as a minimum, pump and fraction


collector (normally system also includes UV monitor and recorder)

 Gradient mixer

 Spare pump or second chromatographic system (optional)

 Chromatographic columns packed with different types of matrixes

 Spectrophotometer VIS (340-800nm) or better UV/VIS (190-800nm)

 Bio-Rad Protein Assay Reagent

 Plastic cuvettes (1.6 ml)

 Stock solutions of salts and buffer components

 Concentrators (VivaSpin 20, 6 and 0.5ml)

 Low speed refrigerated centrifuge

 Filtration Device (such as Filter Holder or Stericup Filter Unit)

 Apparatus and solutions for SDS-PAGE (ideally precast gels)

 Refractometer (a pocket one for sucrose is fine)

 Pippetors and tips

 Eppendorf tubes

 Tubes for fraction collector

9
Preparation and use of stock solutions
It is very convenient to have stock solutions of the main salts and buffers used during
purification. Correctly and carefully prepared stock solutions can noticeably improve accuracy
and reproducibility of the purification procedures.

Stock solution preparation sequence


When preparing stock solutions, follow the sequence below:
Weigh powder → dissolve in about 80% of final required volume of ultra pure water→
adjust pH (for buffers and EDTA only) → adjust to final volume with ultra pure water →
filter (also see poster in Apendix2)

The most useful stock solutions in protein purification are:


 5M NaCl
 4M (NH4)2SO4
 1M Tris-HCl, pH 8.0
o To prepare this solution you need to adjust the pH to 8.0 with concentrated HCl, this
titration generates heat. However Tris buffer is temperature sensitive: raising the
temperature by 3°C decreases pH by 0.1. To make a reproducible stock solution it is
best to adjust pH on a water-ice bath with a thermometer placed in the solution, you
are aiming for pH 8.0 at 20oC.
A significant volume of concentrated HCl is required to adjust pH, therefore Tris
powder should be dissolved in 60-70% of the final volume, pH adjusted to 8.0, then
water added to final volume.

Other stock solutions:


 0.2M - 0.25M EDTA.
o The stock concentration is relatively low due to the low solubility of this compound.
Add 5M NaOH to the solution until all EDTA is dissolved (pH is 7.5-8) before you
adjust it to required volume.
 Good’s Buffers:
o 1M HEPES-NaOH pH 7.0 or 7.5
o 1M MES-NaOH pH 6.0 or 6.5
Unlike Tris buffer, these buffers are not temperature sensitive so there is no need to control
temperatures during their preparation.
It is best to keep stock buffers in the fridge.
Preparation of working buffers from stock solutions
By having stock solutions you can prepare any buffer for protein purification in seconds.
Simply pour required volumes of stock solutions in to a Duran bottle and adjust the volume with
ultra pure water to the top mark on the bottle.
Worked example: to prepare 1 litre of buffer 50mM tris-HCl pH 8, 100 mM NaCl, 2mM
EDTA:
pour 50 ml of 1M tris-HCl, 20 ml of 5M NaCl and 10 ml of 0.2M EDTA in to a 1 litre bottle
and add ultra pure water to 1 litre mark.
Please note that dilution leads to a decrease in buffer pH. Normally we use 50 mM solution
for purification (made from the 1M stock) and the actual pH for tris, MES or HEPES
buffer is about 0.3 pH units lower than in 1M buffer.
For 50mM tris buffer prepared from 1M stock pH 8.0 actual pH at 20oC is about 7.7. However
if we use it at 4oC the pH is at about 8.

10
Chromatography system

 Principal scheme of the chromatographic system:

Buffers Fraction
Samples Pump Column UV
__
Gradient monitor
collector
mixer
Chart recorder
PC

The simple chromatographic system consists of a peristaltic pump, a column and a fraction
collector. A gradient mixer is required if gradient elution of the proteins is used. Fractions are
analysed manually. More advanced systems include UV monitor usually monitoring an
absorbance at 280nm.
Modern systems such as the AKTA Prime and other AKTA types have a little bit different and
more complicated arrangement of the same parts. All compartments are integrated and centrally
controlled through a PC interface.
Please notice that the pump is placed before the column, not after as some people do. Don’t
place the horse behind the cart!

 Evolution of chromatographic systems

o Simplest chromatography system

Electrolyte bridge
Sample
or buffer
Simplest
Gradient
Mixer

Stirrer

Column
Flow is
driven by Analysis of the fractions
gravity is done manually using
spectrophotometer and
gel electrophoresis

Manual fractions
collection

11
o Semi-automated systems (1960-80)

o Modern system (AKTA purifier) (2000+)

This system is an AKTA Purifier FPLC (Fast Protein Liquid Chromatography) machine. It is
operated by PC through UNICORN software and is highly automated. The feature I like most is
the way the chromatograms are saved and presented:

12
 Cold cabinet vs room temperature
You may notice that our AKTA machine is not in a cold cabinet, and that the chromatography is
performed at room temperature while the earlier system is placed in the cold cabinet and
chromatography is done at 4oC. Some labs still put AKTA machines at 4°C (putting it at risk of
damage by condensation etc.). However, the reason that chromatography has historically been
done in cold rooms was to protect proteins from proteolysis during the days-long purification
processes. When proteins were purified from original sources purification procedure lasted for a
few days, one chromatography took a day or longer. It was vital to perform chromatography in
cold to slow down any possible proteolysis and bacterial growth. In contrast, the
chromatography performed on modern systems with 5ml cartridges lasts 20-30 minutes, and
combined with the use of low-proteolysis [Link] strains, the risk of protein degradation at room
temperature is minimal. So the most rational way is to do chromatography at room temperature
and place eluted fractions in the cold cabinet to prevent occasional bacterial growth in them.
 Cleaning of chromatography system
It is extremely important to keep clean all parts of system ( tubing, pumps, sample loops etc.)
o Always pump water through all part of system after chromatography to prevent salt to be
crystallised in the tubes and channels.
o To prevent bacterial growth 20% ethanol wash is usually recommended. However it is
not 100% safe and sometimes bacterial growth still happens. In our lab we use 1-2mM
EDTA solution to keep AKTA systems between purifications. It never failed.

Preparation of chromatographic columns


Chromatographic matrixes
For the basic purification protocol you need a set of 3 columns: one packed with ion exchange
matrix, one with hydrophobic matrix and one with gel filtration matrix.
I suggest the following option:
1. DEAE-Sepharose Fast Flow (weak anion exchanger)
2. Phenyl-Toyopearl 630S or Phenyl-Sepharose (medium hydrophobic matrixes)
3. Superdex-200 (gel filtration)
You also may need columns with different variations of matrixes in case if any of above
columns does not perform satisfactorily.
Other matrixes and columns I suggest to use are as follows:
Q-Sepharose Fast Flow (strong anion exchanger)
CM-Sepharose fast flow (weak cation exchanger)
DEAE-Toyopearl 650S ( weak anion exchanger)
SP-Toyopearl 650S (strong cation exchanger)
Butyl-Toyopearl 650S (strong hydrophobic matrix)
Ethyl-Toyopearl 650S (weak hydrophobic matrix)
Heparin-Sepharose Fast Flow (pseudo-affinity)
Sets of HPLC (FPLC) columns (if you possess the appropriate system)
You may need other types of matrixes, such as Hydroxylapatite, Dye and tag affinity matrixes.
13
Chromatographic columns
Nowadays we have a choice to pack columns ourselves or buy ready-to-use pre-packed
columns. Both options have their advantages and disadvantages.
Option1. Pack your own column.
For our lab scale protein purification we need columns 5-30 ml in volume..
We used to buy empty columns (mainly Amersham –Pharmacia (now GE Healthcare))
C10/10, C10/20, C16/20 and XK16/20 with adapters and pack them in the lab with the listed
above loose matrixes.
Advantages: 1) this is considerably cheaper than pre-packed columns
2) column can be repacked if it gets badly contaminated or dried
Disadvantages: 1) it takes time to pack columns
2) often in house made columns are underperforming the pre-packed equivalents
Column preparation (packing) (except the gel filtration one):
1. Check that all parts of column are in place (according to specification)
2. Fix empty column on a stand in a vertical position
3. Fill bottom outlet with a few ml of ultra pure water
4. Prepare slurry of any matrix taking 1 part sediment matrix and two parts water, warm to
room temperature if matrix has been kept in the fridge. De-gassing under vacuum is
recommended but not overly crucial.
5. Open the bottom outlet of the column, pour the slurry into the column, adding the slurry
portion by portion, the matrix should settle at the bottom of the column and the water
should run through. When all matrix is in the column, continue to add water until matrix
has settled, then close the bottom outlet of the column.
6. Fill the column with water to the top. Using a peristaltic pump, fill an adapter with water
and fit it onto the top of the matrix bed. Press down slightly and close the adapter.
Alternatively you could leave a 5-7mm gap between the top of the matrix and an adaptor
to trap any occasional air bubbles.
Option 2. Buy pre-packed columns
Advantages: 1) No trouble with packing
2) Good performance
Disadvantages: 1) Significantly more expensive than self packed columns
2) They are not re-packable. If they get dried or badly contaminated the only
good option is to buy a new (expensive) one.
For gel filtration it is the best to use a pre-packed column. This is because a self-made
column never gives as good a separation as a readymade one. Gel filtration is a zonal separation
method and because of that the perfection of packing is absolutely essential. In my hands the
best result was 8000 theoretical plates/meter, while pre packed columns show at least 13000.
A 1.6x60cm Hi-Load Superdex 200 column (GE Healthcare) is the best option for the
majority of proteins. For smaller scale purifications and analytical runs we use
1x30cm Superdex200 Increase column (GE Healthcare)
GE Healthcare cartridges to use with AKTA systems
Over recent years, we have moved over to the AKTA purifier and AKTA pure systems due to
their advantages for recording and analysing chromatograms. 5ml cartridges are very
convenient option to use with AKTA systems as they can be combined together to make the
equivalent of 10-25ml columns.
The cartridges contain Sepharose HP (high performance) matrix which consists of smaller
and more uniformly sized particles than Sepharose Fast Flow (FF) and so provide sharper peaks
and better separation. There is a wide range of matrixes available in form of cartridges,
including ion-exchange, hydrophobic and affinity.
GE Healthcare also sells pre-packed (HiPrep) 20ml columns with DEAE-, SP-, Q- Sepharose
FF, but I do not think that they are cost effective, better to pack such columns in-house.
Unfortunately Toyopearl manufactures failed to produce suitable and convenient cartridges for
the use with AKTA systems and these good matrixes are now only occasionally used in our lab.
14
More information on columns and matrixes is provided in Chromatographic steps part.
Columns care
 During chromatography do not allow air to enter the column.
 Also be careful with samples which you apply on a column:
o Make sure that sample is properly clarified and free of any particles which could
block the net on the top of the column (see Cell free extract preparation below)
o Do not overload columns (see corresponding information on chromatography
matrixes below). Proteins tend to be bound on the top of column and if overloaded
it may completely block the flow. If it happens the only solution is to open the
column and mix matrix following by protein elution.
 Column cleaning
o General recommendation is to wash columns after chromatography with a few
column volumes of water and 20% ethanol. This is very safe method but also it is
very impractical. It only worth doing if there are a long (a few months) gaps
between purifications. In our lab we leave ion exchanger columns in 1-2M NaCl
and hydrophobic matrixes in water or no salt buffer.
o If column is contaminated the best way is to wash it with 2-3 CV of 1M NaOH.
Always wash column with 1M NaOH after chromatography if there was possible
protease contamination (for example, if protease was used to cleave tag from the
target protein prior purification).

Preparation of crude (cell free) extract


Disruption of bacterial cells
Methods for cell disruption can be divided into two groups:
1) Non-mechanical methods, including
 freezing-thawing
 osmotic shock
 lysozyme treatment
2) Mechanical methods, including
 ultrasonication
 liquid extrusion (French Press, flow-through press)
Liquid extrusion
The most powerful method is liquid extrusion. If a machine (such as a French press) works well
(all parts are in good order, right pressure is applied etc.) and you have passed the material twice
though the press, the result is typically very good. This method usually outperforms
ultrasonication for fresh living cells such as [Link]. The disadvantage of this method is that the
operating of the equipment involves heavy bomb to handle and important teflon ball is prone to
wear so can fail to provide the right sized channel.
Ultrasonication
In contrast to liquid extrusion, ultrasonication is easy to perform if you have a properly working
machine (no heavy lifting involved). The problem is that it is not as powerful as liquid extrusion;
ultrasonication would not effectively destroy intact living [Link] cells so you have to use it in
combination with non-mechanical methods.
Non-mechanical methods
In the literature, it is common to see lysozyme treatment prior to ultrasonication. I believe this
method is still very popular mainly because people tend to repeat protocols uncritically. In my
experience, there are at least two major disadvantages:
1. You have to add a significant amount of lysozyme which could compromise purification
of your target protein.
15
2. It involves 30 minutes long incubation at 37oC exposing proteins to possible protease
degradation and still needing ultrasonication because lysozyme does not destroy cells but
only makes holes in them.
Lysozyme-free method for cell disruption
I've found a combination of freezing-thawing, osmotic shock and sonication simpler and quicker
than lysozyme based protocols.
1. Cells are collected and pelleted by centrifugation, medium removed and pellet is frozen
at -20oC. Frozen cells can be kept for years before protein purification.
2. On the day of purification, cells are defrosted with 8-20ml of lysis buffer (typically
50mM Tris-HCl, pH 8.0, but see below) per gram of cells and then sonicated on ice. To
prevent protein denaturation due to the heat released by the probe, sonication should be
performed in 2-4 cycles with cooling between sonication sessions. The exact regime
depends on the machine you use and so you need to find the right time and power
empirically. For example, with a Soniprep150 machine we perform 20-25sec cycles at
16-micron amplitude (full power) using a medium probe.
Tip: To save time on this step it is useful to divide cell suspension into 2-4 portions and treat
the portions one after another thereby allowing each portion to cool while you treat the
other portions.
Also, you can add small pieces of ice into the cell suspension between the sonication
sessions for more effective cooling.
Lysis buffer
Lysis buffer has to be chosen accordingly to the particular protocol.
50mM tris-HCl pH 8.0 (referred as Buffer A in this brochure) is typical for most of the
protocols
 For a basic protein with the first column being a cation exchanger, choose a buffer with
pH below 7 e.g. 50mM MES-NaOH pH 6.0
 It is useful to include 1mM EDTA as a good bacteriostatic, but it is not suitable for
proteins containing divalent cations or for His-tagged proteins.
 For His-tagged proteins, add 0.5M NaCl to inhibit anion binding on Ni2+
 Protease inhibitors (PI) are sometimes required and are particularly important if you
have to purify protein from the native organism, or for eukaryotic proteins expressed in
[Link], as they often have extended loops attractive to proteases. Use Roche “cOmplete
EDTA-free” tablets.
On other hand it is not necessary to use protease inhibitors routinely for
purifications of the proteins over expressed in special strains of [Link] as they have low
level of protease activity.
Removal of cell debris (insoluble part of cells)
Practically the only method used for the removal of debris is centrifugation.
A method called differential centrifugation can be applied to separate a homogenate’s
components by size.
 To spin down unbroken cells and other large bits apply 10 000g for 5-10 minutes.
 To pellet inclusive bodies apply 10 000g for 10 min.
 To collect membrane fractions, 1 hour at 100 000g is required.
 To pellet ribosomes apply 100 000g for 3 hours.
Soluble cytoplasmic proteins
Normally to purify soluble cytoplasmic proteins we do not need to remove ribosomes or all the
membranes from the crude extract, we only need to remove big particles (bigger than 10μm -
the mesh size of the net used in a chromatographic column adaptor).
Empirically the optimal protocol has been found to be as follows:
 For JA-20 rotor in J-20 centrifuge: 19000 rpm (~43000g) for 15 minutes at 4˚C
 For JA-25.50 rotor in J-25 Avanti centrifuge: 24000 rpm (~70000g) for 10 min at 4C.
16
Membrane proteins
For purification of membrane proteins you only need to spin down the large pieces (this is done
by centrifugation at 10000g for 10 minutes) and then collect membranes by ultracentrifugation
at 100000g for 1 hour.
Sometimes it is useful to filter CFE prior of loading on an especially precise column. However
it is not easy. It is better to use 0.45µ filter because 0.22µ is quickly blocked. Do not do it for
routine purifications when first column is Sepharose Fast Flow or HP (ion exchange or
affinity).
See Protocol number 2 for more details

Pre-chromatographic steps
Some protein purification protocols include a treatment of the crude extract (CFE). This could be
dialysis, differential ultra centrifugation, addition of a reagent (such as substrates or inhibitors,
etc.) or precipitations of some components of crude extract using different precipitants.
 Dialysis is normally required if CFE was obtained in the buffer which is not suitable for
the first chromatographic step
 Differential ultra-centrifugation is applicable if the target protein (TP) is associated
with a certain part of the cell or with certain organelles. It is not necessary for purification
of soluble cytoplasmic proteins.
 Fractionation of the cell free extract using various precipitants was a very popular
and powerful method in the early days when chromatographic techniques were not
properly developed. Ether, chloroform, ethanol, isopropanol and polyols were widely
used. Nowadays ammonium sulphate is practically the only precipitant that is frequently
used for fractionation of the CFE (in a so called ammonium sulphate cut procedure).
o Ammonium sulphate cut (see Protocol number 4 for the procedure) For this
application ammonium sulphate concentration is usually expressed in a % of
saturation. Saturated solution (100%) at room temperature is about 4.1M. Using
the ammonium sulphate table (see Tables and Charts section) you can find out
how much ammonium sulphate powder you should add to the solution to get a
desirable concentration. During precipitation the protein solution should be kept
on ice or at 4˚C to prevent proteins from denaturing due to heat produced by the
ammonium sulphate dissolving. After this step the protein sample will contain
significant amounts of ammonium sulphate and cannot be used directly for ion
exchange chromatography but can be used for hydrophobic chromatography (after
adjusting ammonium sulphate concentration to required level) or applied on the
gel filtration column for separation or desalting
o Clarification of crude extract by protamin sulphate treatment is another
method that can sometimes be useful. Protamin sulphate (PS) is used to
precipitate out nucleoproteins such as ribosomes and DNA/protein complexes. In
my work it has been particularly useful for clarification of fungal extract. After
PS clarification the sample can be used directly for any kind of chromatography
(see Protocol number 3 for the procedure).
 Denaturing of contaminating proteins by heating has become a rather common
procedure that is especially effective if you are dealing with recombinant protein from a
thermophilic organism expressed in [Link]. If you know the denaturing temperature of the
TP, you can heat the crude extract for 10-20 minutes at temperature 5-10°C lower than
denaturing temperature. This process depends on pH, salt concentration and protein
concentration. Small-scale trials are required to optimise all conditions.

17
Chromatographic steps
Among about a dozen kinds of chromatography the most useful in protein purification are:
Purification (fold)
Ion-exchange chromatography (IEC) 2-10x
Gel filtration or size exclusion chromatography (SEC) 2-3x
Hydrophobic chromatography (HIC) 2-10x
Affinity and pseudo affinity chromatography >100x
To become familiar with the basic theory and methods in chromatography, please read the
useful booklets from GE Healthcare. They are accessible on the website and at minimum you
need to read these five:
 Affinity chromatography. Principles and Methods
 Ion exchange chromatography, Principles and Methods
 Gel filtration, Principles and Methods
 Hydrophobic interaction chromatography, Principles and Methods
 Protein Purification Handbook

Sequence of operations during ion exchange or hydrophobic chromatography :


1. Connect chosen column to the system
2. Wash with 1-2 column bed volumes (CBV or CV) of starting buffer
3. Apply sample. Collect unbound material in the separate container or start to collect
fractions. Collect full tubes on this stage.
4. Elute proteins using either continuous or stepwise gradient of elution agent. The duration
of continuous gradient should be 10-20 CBV (up to 30CV for HPLC columns). With
stepwise elution apply 3-4 CBV of each concentration. Collect fractions (25-50% of
CBV).
5. Clean column with 1-2 CBV of high concentration elution agent
(1-2M NaCl for ion exchange matrix or water for hydrophobic matrix)
6. Check protein concentration in fractions by method of Bradford.
7. Analyse protein containing fractions using SDS-PAGE.
8. Combine fractions containing TP, check volume and protein concentration then calculate
yield of protein after the step.

Tip: To save time on the chromatographic step do not wait until the elution is totally
completed. Start to analyse protein concentration in the fractions after collection of 15-
20 fractions or after about 1/3 of the gradient has been applied on the column.

18
Ion exchange chromatography
Please read “Ion exchange chromatography” booklet for theory and matrix characteristics.
Anion exchange matrixes and their standard columns:
Weak anion exchangers: DEAE-Sepharose Fast Flow, DEAE-Toyopearl 650S
Strong anion exchangers: Q-Sepharose Fast Flow or HP, Resource Q (HPLC), Mono Q (HPLC).
 The latter two columns are high resolution columns which have fine beads and some
pressure is required to run them, therefore they are used with AKTA systems or the
FPLC system and often applied as a last polishing step.
Anion exchange chromatography is favoured as a first chromatographic step.
Normally we use DEAE-Sepharose FF and sometimes Q-Sepharose FF columns.

With AKTA system use HiTrap DEAE FF or HiTrapQ HP cartridges, just screw 2 to 4 of
them together if required.
Cell free extract prepared in Buffer A (50mM tris pH 8.0) can be applied on the column
directly, no extra preparation needed.

Altering column pH
The typical pH range for anion exchange chromatography is from 6 to 9.
Note that it is not easy to change pH of an ion exchange matrix. It would not work if you
simply try to wash column with the starting buffer of 50mM concentration at different pH. To
change pH in the column apply about ¼ CBV of 1M buffer solution of the desired pH,
following by 2 CBV of the starting buffer (with the same pH as the 1M buffer solution).

Main parameters of chromatography are:


 Column size and geometry
 Column’s capacity
 Flow rate
 Shape and slope of elution gradient
 Fraction size
For standard first-step anion exchange chromatography parameter settings are as follows:
 Column Bed Volume: 5-40ml, diameter 1.6cm, cross area 2cm2, bed height 3-20cm.
 Capacity: up to 40 mg of total protein per ml of matrix. Typical loading on the above
column is 100-800 mg of total protein.
One 5ml HiTrap cartridge could take up to 150mg of the cell free extract. Higher
loading affects separation.
 Flow rate: for Sepharose FF and Toyopearl 650S it is 2-3ml/min/cm2. So for the above
column with cross-area 2cm2 typical flow rate is 4-6 ml/min.
For HiTrap cartridges flow rate is 5ml/min.
 Linear elution gradient is the best option for the first step anion exchange
chromatography.
o For weak anion exchange matrixes (DEAE) the final NaCl concentration should
be 0.5M.
o For strong anion exchange matrixes (Q) it should be 1M.

19
o Length of gradient is typically 10-30 CBV.
 For the first step 10 CV is optimal which corresponds to 100-400ml for
a 10-40ml column.
For 5ml cartridges it is 50ml.
So the slop is 0.1M salt/1CV for weak (DEAE)
and 0.2M/1CV for strong exchanger (Q) matrixes.
 For high resolution FPLC columns (e.g. MonoQ, ResourceQ) the slop
can be reduced to 30-50mM/1CV to achieve better separation

 Fraction size should be 25-50% of the column volume.


The sharper the gradient the smaller fractions are to be collected.

Cation exchange matrixes and columns:


Weak cation exchangers: CM-Sepharose FF, CM-Toyopearl 650S
Strong cation exchangers: SP-Toyopearl 650S, SP-Sepharose FF and HiTrap SP-HP cartridges
High resolution ready made columns: Resource S, Mono S

Typical pH range for cation exchange chromatography is from 5 to 7.5.


It is good first step for basic proteins.

All other parameters are similar to anion exchange chromatography.

20
Hydrophobic interaction chromatography

Please read “Hydrophobic interaction chromatography” booklet for theory and matrixes.

Hydrophobic matrixes and columns


In our lab we use the following matrixes:
Ether Toyopearl 650S; weak hydrophobic matrix
Phenyl Toyopearl 650S; medium hydrophobic matrix
Butyl Toyopearl 650S; strong hydrophobic matrix

Phenyl-Sepharose FF is readily reported in literature, but I found that Toyopearl 630 matrix
(TOSOH) is significantly over performing it in respect with peak sharpness and resolution.
With AKTA systems we use Hi Trap Phenyl HP cartridges because TOSOH does not
manufacture Toyopearl 630 cartridges suitable for use with AKTA systems. However Phenyl-HP
cartridges perform much better than Phenyl-Sepharose FF and so have been successfully used for
purification of a number of proteins in our lab.
GE Healthcare also produces 1ml and 6ml Resource ETH, Resource ISO and Resource PHE
FPLC columns. I have not find them very useful mainly because HIC is very rear used as a
polishing step.

Salt concentration in the sample is critical


To allow proteins to bind to a hydrophobic column the sample should contain a high
concentration of salt. Usually ammonium sulphate (AS) is used. More rarely potassium chlorate,
sodium sulphate or other salts are used.
The typical ammonium sulphate concentration in the protein sample should be 1.5-1.8M,
which is OK for majority of proteins.
For most hydrophilic proteins AS concentration should be increased to the point when it bind.
For most hydrophobic proteins use of 2M KCl instead of AS can be suggested.
Hydrophobic chromatography parameters
 Capacity of Toyopearl matrixes is up to 30 mg of total protein per ml of matrix. Optimal
loading is 1-20 mg of total protein per ml of matrix.
It also applies to Hi Trap Phenyl-HP cartridges
 Flow rate is 1-1.5ml/cm2 for the Toyopearl matrixes
For Hi Trap Phenyl HP cartridge flow rate is 5ml/min
 Elution gradient is typically linear, 10-20 CV, from high salt (AS) concentration to
buffer without salt or sometimes to a lower concentration of salt.
Optimized starting buffer should normally have a concentration of salt (AS) which is
about 0.2M higher than the concentration of the salt at the protein elution point and the
final buffer should have no AS or have an AS concentration which is about 1M lower
than its concentration at the elution point.
If protein elutes from the hydrophobic column at a low concentration of AS, you should
wash column with the buffer without AS after the completion of elution gradient in order
to push protein out the column and tubing into the collection tubes. Apply at least 4-5CV
of buffer.
It is very useful to check AS concentration in the fractions with the TP to be able to compare
different runs of purifications of the same protein and so to work out optimal starting and final
buffer for the gradient. In our lab we use a convenient pocket sugar refractometer and Chart
“Sugar refractometer for ammonium sulphate” (see Tables and Charts section)

21
Gel filtration (SEC)
Please read “Gel filtration. Principles and methods” booklet for theory and matrixes.
See also Appendix 2.2

The main feature of this type of chromatography is that it is zonal separation, so columns are
long and samples are small to allow zones to be separated properly.
Purification power of this step is not high. Generally speaking we could expect about half of
the contaminating proteins to be separated from the TP during this step. However for small
(<20kDa) and big (>400kDa) proteins, gel filtration is more effective and often provides a
significant purification.
It makes gel filtration a suitable polishing step that also provides additional information on
the oligomeric state of the TP and quality of the preparation.

In our lab we use Hi-Load Superdex 200 1.6x60cm columns from GE Healthcare
 Total volume: 120 ml
 Void volume (V0): 45ml
 Separation range MW: 600KDa – 10KDa
 Sample: volume 0.5-2ml, no restrictions on buffer composition
 Loading: up to 50 mg of total protein (20 mg per protein for the best result)
 Flow rate: 1-1.5 ml/min
 Elution with continuous buffer (pH 5-10, salt concentration 0.1M or higher)
 Collect 2ml fractions after void volume or start collection later if you know elution
volume (Ve) of the TP peak.
Take care with these expensive columns
 Do not allow air to get into the column. If you do accidentally dry the column, even so
badly that cracks appear, do not panic and wash column with plenty of water at flow
rate 2-3 ml/min until all the air has been pushed out of it.
 Time to time, after couple of dozen of runs, the net on the top adapter get partially
blocked and has to be replaced with the new one. Please, use the instruction in the
leaflet provided with the column (or find one on the Web). This is very important to do
it properly, do not damage all important top layer of the column bed. After drying event
especially and if the net replacement was not done to a perfection, a column
performance could decline a little bit (say losing 1000-3000 theoretical plates), but
normally still remains good.
Never ever try to repack those expensive columns!
According to my experience self packed columns never come close in performance to the ready
made ones. My best attempt to pack the column with the fresh loose Superdex200 prep grade
matrix was yielded in producing the column with resolution power of 8000 theoretical
plates/meter while for commercial columns the figure reproducibly is above 13000. Back then I
was not happy with my column and decided to repack it and had it done following all rules to
the scratch. The result was 5000 theoretical plates/meter.

 Standard buffer for gel filtration in our lab is 50mM tris-HCl pH 8.0, 0.5M NaCl,
which is good for the majority of proteins.
Any other buffer at reasonable pH could be applied, just avoid low salt conditions. This
prevents absorption of proteins on the matrix.

 If required, gel filtration can be used to exchange buffer in the protein sample for the
next purification step.

22
 To estimate MW (molecular weight) and oligomeric state of your protein you can
use chart “Calibration plot for Hi-Load Superdex 200 column” (Tables and Charts
section). This chart was produced for the "standard buffer" (50mM tris pH 8.0, 0.5M
NaCl).
 The slope of a calibration plot depends considerably on the salt concentration in the
elution buffer. See chart "Calibration plot at various salt concentration".
 Gel filtration matrix may change its properties
Above calibration plot is typical for the 16x60Hi-Load Superdex 200 column and using it
for your MW estimation you most likely will get a fair result. Nevertheless be aware that
when column is in use for long time, after drying event or net replacement the separating
properties of the column could change. The most drastic change I noticed in a separation
properties of the Superdex 200 column was so big that the calibration plot of the column
became more like that of Superose 6 matrix. The only explanation I could give for this is
that dextran component of the beads was destroyed (probably by one of the “proteins of
unknown function” which was purified on the column).
 Do calibrate your column each time when you want to estimate MW of your
protein. Run at least one mix of 4 calibration proteins in the same buffer as your
protein.
It is convenient to use Low Molecular weight and High Molecular weight Gel
Filtration Calibration Kits from GE Healthcare. Just follow the instructions in
the booklet. However these kits are expensive and you could use some other suitable
proteins for calibration. See “Calibration of gel filtration column” protocol.
 Gel filtration is not an accurate method to measure MW or oligomeric state of
the protein. Proteins are separated by their size and not by MW. Proteins with the
same MW could have a different shape and compactness therefore their sizes and so
called Stock’s Radius could be different and so could the elution volume (Ve) and
apparent MW. Another possibility for misidentification is if the protein has some
affinity to the matrix and so elutes later than it should according to its MW.

See also Appendix 2.2 for more information.

23
Affinity chromatography
Refer to “Affinity chromatography. Principles and methods” for theory and applications.
In our daily protein purification routine we either use Pseudo affinity chromatography or
tag affinity chromatography to purify tagged proteins.
Pseudo affinity chromatography
We refer to Pseudo affinity chromatography when matrixes with cross-linked ligands
similar in structure to substrates of some enzymes are used for their purification.

 Heparin matrix for DNA binding proteins


Typically Heparin chromatography is used as a first step in DNA-binding proteins
purification protocols
In the lab we use
o Heparin-Sepharose Fast Flow columns (10-20ml)
o 5ml Hi-Trap Heparin HP cartridges for use with AKTA
 Capacity of Heparin matrixes is about 1-5mg of DNA-binding protein per
ml of matrix.
 Flow rate 3-4ml/min/cm2.
 Elution normally is performed by 10 CBV of a linear gradient of NaCl
concentration. Starting and final concentrations of NaCl should be
determined for each individual protein, but typically the gradient is 0 - 1M
NaCl.

 So called Red and Blue matrixes for purification of NAD/NADP dependant


proteins
o Dye cross-linked to the matrix is somehow similar to NAD or NADP. Under
the certain buffer conditions (these need to be found for each NAD/NADP
dependant protein) the enzyme binds to the column and then can be eluted
either by high NaCl concentration or by NADH/NADPH solution in the
binding buffer.
“Dye” chromatography is widely used for purification of dehydrogenases.
My personal experience with this type of chromatography I would describe as a
disappointing and even frustrating. This chromatography has no universal approach and
thus specific conditions have to be found for purification of every particular dehydrogenase.
These conditions include type of immobilised dye, binding buffer (pH, composition and
concentration), as well as sample volume and concentration, elution mode and buffer, etc.
Generally speaking “dye” chromatography has to be slow (0.5ml/min/cm2 or less), sample
has to be rather concentrated, and column has to be relatively big, as capacity of a dye
matrix as a rule is low. Elution of the target dehydrogenase from the column is not straight
forward either. The best option is to use bio specific elution with NAD(H), but it is
expensive option, as for the good recovery concentration of NAD(H) has to be relatively
high. More often elution is performed by increasing concentration of salt or changing pH.
Step or gradient elution could be employed.
Purity of the dehydrogenase after this chromatography rarely is really high (depends on
level of over expression). Often another purification step is required.
Yes, yield/purity combination could be better if you employ properly developed “Dye
chromatography” protocol, but you never can be sure in the reproducible result. If you go
for the new batch of the matrix, different expression protocol, or simply have a long time
gap between purifications, then be prepared for the trouble. See examples in Show cases
part.

24
Purification of His-tagged proteins
Among a number of tags in use the most common is 6xHis tag. Recently 10xHis tag is
developed, which is good news as it has higher affinity to Ni-matrix.
 Ni2+ charged IDA (imminodiacetic acid) or NTA(nitriltriacetic acid) crosslinked to
agarose or Sepharose beads are used to fish His-taged protein out from the cell free
extract .
o There is a wide range of Ni2+ charged matrixes, readymade columns and cartridges
available from many companies. Among 3-4 brands which I have tried I’ve found
His Trap cartridges (GE Healthcare) to be the best with respect to their capacity
and separation power. They are convenient for use with the AKTA system, but are
relatively expensive and not easy to clean. In my practice typical life time is about
30 runs.
o It is at least twice as cheap to buy bulk imminodiacetic acid-Sepharose from
Sigma, make own columns of any size and charge them with Ni2+. It is good option
for making very small or big columns or for batch method.
Properties of the different brands of Ni-columns and matrixes differ significantly
 Refine the elution conditions for your TP for any different brand or type of the Ni-
column used.
Conditions for Ni-beads chromatography
 Buffers: mainly two types of buffer are used, PBS pH 7.4 and Tris-HCl pH 8.0. Also,
to suppress ion-exchange properties of Ni2+, 0.5M NaCl is normally included. Prepare
cell free extract in the same buffer.
 Capacity of different brands of the Ni-beads noticeably vary from one to another, but the
most serious factor which contributes into Ni-beads capacity is His-tagged protein itself.
It seems that accessibility of His tag to Ni in the great degree depends on the protein
fold and so is amount of the TP which binds to the column. The highest capacity I have
observed was 30mg per ml of the beads, and lowest was just 2mg/ml. This also affects
the elution concentration of Imidazole.
 Elution
To elute protein from a Ni-column continuous or stepwise gradient of Imidazole
concentration is used. According to my experience most of the His-tagged proteins elutes
with Imidazole concentration in range 0.05-0.5M. Most of them are eluted at 150-
200mM. In a couple of cases the elution concentration of Imidazole was higher than
0.5M.
 Stepwise elution
People who have no chromatographic equipment have to purify His-tagged
proteins either by batch method or using syringe with cartridges. They only can
use stepwise elution, which could yielded in pure protein if level of TP expression
is high and concentrations of Imidazole on each elution step is optimized.
 Continuous gradient elution
Much more reliable is a continuous gradient elution. It is convenient to use
AKTA system and His-Trap cartridges. Typically for a new protein it is useful
to apply a gradient of Imidazole concentration from 0 to 0.5M in 10CV. There are
a significant number of proteins in the cell extracts which have some affinity to
Ni. They elute from the cartridge with about 50-80mM Imidazole as a sharp peak.
Typically His-tagged proteins are eluted with higher concentration of Imidazole
as a second, wider peak. Some of the His-tagged proteins elute just after
contaminations and so the gradient has to be optimized, normally keeping 10CV,
but finish at 0.25-0.35M Imidazole. In some cases we have to apply 2-3CV of
30mM Imidazole wash to remove majority of the contaminating proteins before
applying the gradient or add 20mM Imidazole in lysis buffer.
Latest development on His-tag front is 10His tag. It may significantly improve binding of a TP
to a column and so improve purity of the preps on this stage.

25
 Cartridge care
After a number of runs (10-30, depends on amounts of the cell free extract applied)
a cartridge became contaminated and flow rate significantly reduced. These cartridges
could be cleaned up using 1M NaOH (see Protocol “Ni-chelating cartridges: cleaning
and recharging”).
o In some labs people strip Ni with EDTA after each run or after a few runs. I do not
think this method is effective as contaminations stick to beads most likely
hydrophobicaly.

Purification of GST-tagged proteins


The second widely used tag is GST. Be careful when you choose GST as a tag. GST is a
dimer, so, if TP is oligomeric as well, it may lead to formation of big conglomerates.
Glutathione –Sepharose (bought from GE Healthcare) is used to purify GST-tagged proteins.
We can use loose Glutathione-Sepharose in batch method, pre packed gravity driven columns,
spin columns or cartridges. Usually PBS buffer or Tris buffer pH 8.0 is used. Capacity of the
matrix is at least 3mg/ml of matrix (25mg/ml according to manufacturer). In my experiments
there was no trouble with the binding, the main trouble I had with purification of GST-tagged
proteins was an incomplete elution. The recommended 10mM glutathione concentration elutes
just fraction of the protein from the matrix and after increasing concentration to 50mM
significant amount of the protein still remained bound to the matrix.
Check and adjust pH in elution buffer!!! Reduced glutathione is very basic.
Having GST-tagged protein with the protease cleavage site appeared to be more preferable and
increase recovery significantly if “in column” cleavage is used. However cleavage is a tricky
procedure, which is not very reproducible. Also it is not uncommon to have target protein
nicked or even destroyed by a protease.
Purification of MBP-tagged proteins
Maltose binding protein is a good tag which also can help with protein folding.
Amylose-Agarose is used for purification. Typically it is gravity forced columns. I use PD-10
(GE Healthcare). Buffer composition is not critical, but better to avoid extreme pH or salt.
Capacity is about 5mg/ml. However, it seems that incomplete binding is a common event. Also
Amylose-Agarose matrix is losing some amylose after each run and capacity get significantly
reduced after 5-6 purifications. Taking all this in consideration, I would recommend repeating
purification of MBP-TP from the unbound material to increase yield. 10mM maltose has to be
used for elution. Collect fractions of 25% CV. Elution is complete under these conditions.

Low affinity chromatography


Low affinity chromatography is a special technique which can produce very good result (See
show case). It may be applied with any type of matrix, ion exchange or affinity. You can found
that protein have low affinity to given type of matrix if it appeared in flow through material and
also in first fractions of washing and elution. In this case try the following protocol.
Prepare protein sample or CFE in as small volume as possible. If it is a CFE, use 3-4 volumes
of lysis buffer per 1 volume of cells. In this case apply 3-4 cycles of sonication and longer
centrifugation.
Column has to be at least 3 fold bigger than the sample volume. Ideally to have 1:5 ratio.
Apply sample and start to collect fractions (about 20-25% CV), wash column with 2-3 CV of
starting buffer continuing to collect fractions. TP will appear as a separated peak just after
unbound material. Wash column with high concentration of elution agent to clean up the
column.

26
III. “Common sense” strategy
for protein purification
General principles and tips in “common sense” strategy
Common sense is the best guide in protein purification
For structural studies our goal is to purify protein to a reasonable purity
(90+%) with the best possible yield in the shortest possible time and with a minimum effort.
Taking all this into consideration common sense tells us that the best possible strategy
for protein purification would be one started with affinity or pseudo affinity chromatography. This
can give you purification fold of tens or even hundreds and results in almost pure protein even if
the level of TP expression is not high. An affinity matrix could be a matrix with cross-linked
substrate, pseudo substrate or inhibitor. The problem is that we need to create a special matrix and
to optimise conditions for chromatography for each protein individually; this may take a lot of
time.
The alternative is Tag Affinity Chromatography, which is now widely used. The
protein gets expressed with a tag genetically attached to it. The most common tags are His 6
(fished out on a Ni immobilised column) and GST (fished out on a Glutatione column). There are,
however, some restrictions to these methods. Firstly, it is not always possible to express tagged
protein in a properly folded, soluble form. Secondly, proteins with tags are useful for many
applications, but not for all. Often tags should be removed with the “specific” proteases and so
further purification steps are required and also complications may occur with the protease
presence.
In certain cases pseudo affinity chromatography could be considered as a first
chromatographic step in the purification protocol:
Heparin chromatography should be used for DNA-binding proteins,
Dye chromatography may be used for NAD/NADP binding proteins
For purification of the majority of enzymes and other soluble cytoplasmic proteins, we
propose “Common sense protocol” based on using 3 different types of chromatography
separating proteins by their
charge (ion exchange chromatography, IEC),
hydrophobicity (hydrophobic interaction chromatography, HIC) and
size (gel filtration, or size exclusive chromatography, SEC).
Common sense dictates the sequence of the steps:
1. IEC. It is logical to prepare cell free extract in low salt buffer pH 7-8 and apply it directly on
an ion exchange column. For acidic proteins and some basic proteins I propose to use anion
exchange chromatography on a DEAE-Sepharose FF column as a default first
purification step applying 10CBV of a 0-0.5M NaCl gradient in tris-HCl buffer pH 8.0
2. HIC. After IEC it is easy to prepare the sample for hydrophobic chromatography by addition
of ammonium sulphate. At this stage an ammonium sulphate cut could also be considered.
3. SEC. After hydrophobic chromatography, the protein can be concentrated by precipitation
with ammonium sulphate or by a milder method, using concentration by ultra filtration
(pressure unit or spin concentrators) and applied onto a gel filtration column typically
equilibrated in buffer 50mM tris-HCl pH 8.0, 0.5M NaCl. Gel filtration could also be
performed using a buffer suitable for the further use of TP (for example, 50mM phosphate
buffer pH 6.5, 50mM NaCl for NMR experiments) but low salt conditions should be
avoided.
As a rule, these 3 steps are enough to purify over expressed protein to purity of 90+% (this is
in cases where the level of target protein (TP) expression is higher than 10% of total cell
protein). If the level of TP expression is high (20+%) it may be that only 2 chromatography
steps are required to reach an acceptable level of purity (IEC – SEC, HIC- SEC or IEC-HIC).
27
In some cases, especially if the level of TP expression is low, a fourth step should be
considered which could be HPLC ion exchange chromatography as a first choice, alternatively,
low pressure IEC on a different type of matrix (at the same or different pH as that of the first
IEC), HPLC hydrophobic chromatography, chromatofocusing or possibly even more exotic
solutions can also be employed, but I never need to do it.
Hydrophobic chromatography is not so easy to adapt. Unfortunately unlike the
universal first purification step (IEC on DEAE-Sepharose column with uniform parameters)
HIC has to be optimized for every TP.
In the majority of cases a Phenyl-Toyopearl 650S column can be used successfully with
gradient of 10CV from 1.5-0M AS in tris-HCl buffer pH 8.0. Also Phenyl-HP cartridges are
useful if AKTA system is employed. However in some cases purification could benefit
significantly from using a more specific gradient or different type of matrix (strong Butyl-
Toyopearl or weak Ether-Toyopearl).
A serious problem is that for some proteins hydrophobic chromatography is not at all
suitable as they bind to a hydrophobic matrix irreversibly. During development of the
purification protocol I suggest to use about 20% of TP sample obtained after IEC to test HIC
compatibility in order to avoid losing the whole pool of the protein on a hydrophobic column.
In the case when HIC can not be applied second ion exchange chromatography could be
considered as a second or third (after SEC) purification step. This could be HPLC ion
exchange or low pressure IEC on a different type of matrix at the same or different pH as
that of the first IEC.
HPLC ion exchange chromatography was proved to be a powerful method and in some
cases may replace gel filtration or hydrophobic chromatography. Particularly I found it useful
for basic proteins. However, be aware that Resource and Mono matrixes used for HPLC IEC
seems to be rather aggressive with respect to non-specific irreversible protein binding. It varies
from protein to protein, so sometimes you can get your TP with excellent purity but very
disappointing yield.
About 60% of 360+ proteins on my list were successfully purified using above strategy.
Further 10% were DNA-binding proteins purified by Heparin chromatography and
20% were His-tagged proteins purified using Ni-NTA chromatography
About 5% of purifications failed due to protein instability or lack of soluble expression
In some cases, especially if level of TP expression is high it may only takes one day to
develop a proper "one day purification protocol”. Often, when optimisation of hydrophobic
chromatography is required by running and analysing the test HIC or if TP expression level is
low the development may take two or, in the most complicated cases, three days to finish.
Once developed and refined a three step purification protocol can be completed in one
working day (8 hours or so). As a rule there is no need to run SDS-PAGE after each step, you
can rely on previous purification to choose fractions with TP after each chromatography.
To achieve smooth quick purification you should have things prepared beforehand:
 Stock solutions
 Columns
 Sonicator
 Chromatography systems (it is convenient to have a separate system for gel
filtration). In case of unavailability of a second system, use spare peristaltic pump to
equilibrate gel filtration column while first and second purification steps are in
progress. The second system is not required if you use default buffer (such as 0.5M
NaCl, tris pH 8.0) for gel filtration.
 Bradford reagent, spectrophotometer and cuvettes
 SDS-PAGE equipment and solutions (or ready made gels) Apart from using the
optimal sequence of procedures to save time during protein purification there is a
number of Time saving tips (see Appendix2.3) Also always follow the
Golden rules (see Appendix2.4)

28
Algorithm for development of purification protocol for soluble over-
expressed protein

BLOCK I. Preparations
1. Prepare stock solutions, columns and chromatographic systems.
2. Perform a solubility test on the batch of cell paste that you are going to use and confirm
that TP was expressed as a soluble protein (see Solubility test protocol in Protocols section,
number 8). Estimate the level of expression.
If during this test you discover that the TP reversibly precipitates in low salt conditions you
may consider using this property at the first step or later in the purification procedure.
3. Using ExPasy database find information on the target protein (TP). Using ProtParam Tool
produce a primary structure analysis. Work out MW, amino acid composition, isoelectric
point (pI) and extinction coefficient of the protein.
4. If the protein has Cysteines, you may consider adding 1mM DTT to all buffers. However in
my practice I've found that it makes no difference on the redox state of the cysteins in the
protein whether buffers contain DTT or not.
5. Prepare cell free extract (CFE) (see Crude (cell free) extract preparation protocol in
Protocols section, number 2).
 For acidic and neutral proteins (pI<8) use Buffer A (50mM tris-HCl pH 8.0).
 For basic proteins (pI >8) use Buffer A’ (50mM MES-NaOH, pH 6.0)
 For our scale the optimum amount of total protein in CFE is 75-500 mg (1-10g
of cell paste).
Save 0.1ml of the CFE for gel analysis
BLOCK II. Acidic and neutral proteins. Anion exchange chromatography
For self-made columns:
 Wash 20-30 ml DEAE-Sepharose FF column with buffer A. Flow rate 4-5ml/min.
 Apply CFE sample on the column. Collect flow through material.
 Elute proteins with 300 ml of a linear gradient of NaCl from 0 to 0.5M in buffer A.
 Collect 8 ml fractions.
For AKTA system:
o Depending on total protein in CFE use one (total protein <150mg) or two 5ml cartridges
DEAE FF.
o In program equilibrate column with 2CV of buffer A. Flow rate 5ml/min.
o Sample applied and column washed with 1CV of buffer A. Collect whole tubes.
o Gradient: 10CV 0 to 50%B (B=A+1M NaCl).
o Fractions: 2-2.5ml for 1 cartridge or 4ml for 2 cartridges.
6. A TP with pI below 6.5 most likely is bound to the column.
However, collect flow though fraction in the separate container or start to collect fractions, do
not discard it.
 If TP has activity which can be easily assayed (time required for assay is shorter than
time required for SDS-PAGE analysis) go to step 7,
 If assay is not possible go to step 8.
If TP has pI close to 7, then it’s probable that it does not bind to the DEAE-Sepharose
column. However, some proteins despite having a high calculated pI have acidic domains and
so they can be bound to the column.
 If you are monitoring TP by activity, calculate total activity in the flow-through fraction
to be sure that all activity is there.
 If an activity assay is not available, rely on protein concentration in flow-through
fraction. If it is lower than 30% of the protein concentration in CFE, it is likely that
protein stays on the column. To be on save side, run gel to find TP (step 9)
 If TP does not bind to the column, go to step 11.

29
7. Analysis for activity. Analyse every third/fourth fraction for activity.
 When a fraction with activity is found, assay each fraction around the active
fraction to find every fraction that is active.
 Check protein concentration in those fractions using Bradford method and calculate
specific activity.
 Combine 2-4 fractions with the highest specific activity, taking about 80-90% of all
activity. Only take fractions with higher specific activity than in CFE.
 If specific activity of pure TP is known estimate its purity in the sample if it is
higher than 60% go to step 10, if it is lower go to step 11.
 If specific activity of pure protein is unknown, go to step 11.
8. Analysis of protein concentration.
 Analyse protein concentration in every second fraction. If expression of TP was
higher than 20%, you will probably find a very distinct protein peak, normally in 4-
6 fractions which most likely is a TP.
 To find a TP for sure run SDS gel, step 9.

Nucleic
acids

Flow-through
fraction Typical
DEAE FF
chromatogram

9. SDS-PAGE analysis.
 Only fractions containing protein should be analysed, including the flow through
fraction. It is not necessary to check each fraction, every second fraction is enough.
 Prepare samples for a gel analysis as follows:
o Calculate and take volume of CFE containing 15-20g of CFE
o Suspend cell debris in the same volume of water as it was for CFE (the best
way to obtain fine suspension is to sonicate it briefly). Take the same volume
from suspension as for CFE
o Take the same volume from flow-through fraction
o From the fractions take equal volumes so that protein in each sample remains
between 2 and 25g. For example, the highest protein concentration in
fractions is 1mg/ml, so take 20-25l samples from fractions with protein
concentration  0.1 mg/ml. Normally in this step there are about 15-25
fractions containing any significant amount of protein, so a 15 well gel
normally suits the analysis.
o Add reducing agent and SDS sample buffer in the tubes and boil for 1 minute
in the preheated heating block. Apply samples on gel and run.
 Once the gel run is completed, stain gel for 5 minutes with fresh stain and destain it
for about 10 minutes. Even better if you can use InstantBlue stain (Experion) or
similar stain, then you can see the bands in 5 minutes. Analyse gel to find fractions
with the TP.

Typical gel
analysis for
DEAE FF
chromatography

CP CFE 4 10 12 14 16 17 18 19 20 21 22 24 fractions
30
Combine 3-4 fractions with the highest content of the TP
Check volume and protein concentration and calculate total protein in the sample
If purity of the sample  60%, go to step 10, if it is lower go to step 11.
If TP is found in the flow through fraction, go to step 18
Sometimes protein has low affinity to DEAE FF. In this case you can see protein in
flow-through fraction and in the first fractions of wash and elution. In this case try
low affinity chromatography protocol (page 26).
10. Concentration.
 Concentrate protein to 1-2 ml using a Viva Spin 20 concentrator with appropriate
MWCO. Go to step 17.

BLOCK III. Ammonium sulphate cut


11. AS cut. Perform analytical AS cut (see Protocols number 4).
 If analytical experiment shows that it is possible to obtain more than 60% pure TP using
AS cut, perform preparative AS cut (see Protocols) then go to step 17 for SEC
Alternatively take simplified approach.
 Take 0.1ml of 4M AS in the eppendorf tube and add 0.1ml of the protein sample (2M AS
precipitation).
 Spin down at 13-20000g for 2 minutes.
 Separate supernatant fraction, check protein concentration and work out how much of the
total protein has precipitated out.
o If you have more than 50% of total protein precipitated (presumably TP is in the
pellet) go to step 12,
o if less than 15% precipitated (you can presume TP is in supernatant fraction) go to
step 15,
o if more than 15% but less than 50% has precipitated, add 70µl of 4M AS (to 2.5M)
in to supernatant fraction and spin down pellet again. Check protein concentration.
If more than 50% of protein precipitated go to step 12, if less, go to step 15
o If you use activity to monitor TP, apply assay to reveal TP distribution between
fractions.
12. Test of AS pellet solubility. Dissolve pellets in 50-100µl of buffer A,
 Spin down any insoluble pellets in the bench top centrifuge at maximum speed for
2min.
 Check protein concentration in the supernatant fraction and work out how much of the
protein has been recovered from the AS pellets.
o If there is poor recovery of protein from the pellet, go to step 13.
o If there is not much insoluble material and recovery of protein from the
ammonium sulphate pellet is reasonable, go to step 14.
13. Rare event when AS precipitation is irreversible:
 Take 0.3 ml of the TP sample and add 0.1 ml of 4M AS (this makes 1M AS in the
sample).
o If protein precipitates, go to DC(3).
o Otherwise keep adding 4M AS in 10-20 l portions to find maximum AS
concentration at which the TP still stays in solution. Consider this AS concentration
as a starting buffer for test HIC. Take about 20% of the whole TP sample, add
appropriate volume of 4M AS to keep TP in solution and run test HIC as in step 15
with appropriate corrections for the starting buffer. There is a high possibility that
TP will not bind to the column, in which case go to DC(3).
14. AS precipitation.
 Take the whole TP sample and add equal volume of 4M ammonium sulphate. Add 1.7
volumes if TP precipitates with 2.5M AS.
 Spin down pellets for 5 min at 19-24K rpm.
31
 Separate supernatant fraction and dissolve pellet in 1-2 ml of buffer A,
 Spin down any insoluble material, check protein concentration and calculate total
protein in the sample.
You should have a good recovery of protein in the sample (70-80%), go to step 17, run SEC (gel
filtration) and you will have your protein purified.
Do not discard any of the pellets or supernatant fractions, keep them for gel analysis
BLOCK IV. Hydrophobic chromatography (HIC)
15. Test HIC.
 Take 20% of the TP sample and add 0.6ml of 4M AS per ml of the sample (to 1.5M
AS).
 For self-made column:
Wash 10-20ml Phenyl Toyopearl 650S column with 20-40ml of buffer A + 1.5M
ammonium sulphate. Flow rate 3-4ml/min.
o Apply sample supplemented with 1.5M AS onto the column.
o Collect flow-through fraction in the separate container.
o Elute with 100-200 ml (10CV) of a reverse gradient of ammonium sulphate in
buffer A (1.5-0M AS). Then wash column with 1CV of buffer A and 3 CV of water
Collect 5 ml fractions
 For AKTA system:
Use 5ml Phenyl-HP cartridge
o In program equilibrate column with 2CV of buffer B. Flow rate 5ml/min.
o Sample applied and column washed with 1CV of buffer B (A+1.5M AS). Collect
whole tubes.
o Gradient: 10CV 100%-0 B, then 3CV of 0%B
o Fractions: 2.5ml
 Check protein concentration in every second fraction, including flow-through fraction,
buffer wash and water wash.
 Run gel to analyse the elution profile. The gel should include: MW markers, CFE, TP
sample after DEAE and before addition of AS, flow-through fraction (if there is a
significant protein concentration), fractions containing protein, including buffer wash
and water wash if there is any protein detected. Quickly stain-destain gel to reveal
fractions with the TP.
o If there is no TP revealed, it means that you probably cannot use hydrophobic
chromatography for this protein – go to DC(2) (difficult cases).
o If you can find TP on the gel, work out the AS concentration required for its elution.
Using refractometer and Ammonium sulphate-Sugar refractometer chart,
measure AS in the fractions with the TP.
 Refine AS gradient: it should start with AS concentration being 0.2M higher than
the concentration at elution point. If protein elutes early in the gradient (AS
concentration higher than 1.2M) it is useful to get the final AS concentration in
the gradient to be 3 times lower than the starting one. If it elutes later than 1.2M,
it is better to have buffer A without AS as a final buffer. Go to step 16.
o If TP does hot bind to the column, increase AS in the sample and in the starting
buffer to 2M and repeat chromatography.
16. Main HIC. Take rest of DEAE sample and add 4M ammonium sulphate solution to bring
AS in the sample equal to refined starting buffer. Save 0.1 ml of the sample before addition of
AS for later gel analysis.
 To calculate volume of 4M AS to be added to the sample (VAS), use formula:
VAS = (VS x SBC)/(4 - SBC) ,
Where VS is volume of the protein sample and SBC is AS concentration (M) in the
starting buffer
 Clarify sample by centrifugation for 5-10 min at 45000-70000g.
 Apply sample on a column and elute proteins with 10CV of refined AS gradient.
32
 Check protein concentration in fraction.
o If you find a distinct protein peak, combine 2-4 fractions with highest concentration
and go to step 10 (concentrate protein on Viva Spin concentrator).
o In the relatively rare event that there isn’t a distinct protein peak or there is more
than one peak revealed, run gel to analyse each fractions with protein. Also take for
gel: CFE, DEAE sample and MW markers. Combine 2-4 fractions with purest TP,
concentrate it by ultrafiltration or precipitate with AS to prepare sample for SEC
o If protein was already purified by gel filtration, it should be pure - go to F. In the
unlikely case that TP is still not pure, go to DC(1).

BLOCK V. SEC (Gel filtration)


17. SEC.
 Apply 1-2.0ml sample of TP onto a 1.6x60cm Hi-Load Superdex-200 column pre-
equilibrated with buffer A + 0.5M NaCl.
 Run gel filtration at flow rate 1-1.5ml/min.
 After 45 ml start to collect 2ml fractions.
 Check UV elution profile. When UV peak is out of the column check protein
concentration in each fraction across the peak.
 Run gel to analyse fractions containing the protein.
o On this gel there should be present: MW standards, CFE sample, DEAE sample,
sample applied on the SEC column and each fraction across the protein peak
(typically 6–10 fractions). Take 10-25µg of total protein/sample.
o When gel is completely destained, estimate purity of the TP in the fractions.
 If you have fractions with the TP of a suitable purity ( 80% for crystallization if
there are no major contaminants) combine 2-4 fractions with the most pure
protein. Go to F.
 If protein is not pure enough and was not subjected to AS cut or HIC
chromatography, go to step 11.
 If TP is not pure after a three step purification, go to DC(1).
BLOCK VI. Neutral proteins
18. If all TP comes unbound trough DEAE column:
 Perform analytical AS cut on a flow-through DEAE-Sepharose fraction (see Protocols).
o If TP reversibly precipitates with AS concentration of 2.5M or less, go to step 14.
o If it stays in solution at 2M AS go to step 15 ( test HIC)
o If precipitation is irreversible, but TP precipitates at AS concentration higher than
1.5M, go to step 13.
o If TP irreversibly precipitates with 1.5M AS, go to step 19.
19. TP does not like ammonium sulphate. Try pH 5.5 precipitation:
 Take 1-2 ml of flow-through fraction and dialyse it against 100 ml of 20mM Na Acetate
buffer pH 5.5 overnight.
 Clarify sample in refrigerated centrifuge, 15000-25000g for 10 min.
 Separate supernatant fraction from the pellet.
 Check volume of supernatant fraction and suspend pellet in the same volume of Buffer
A.
 Check protein concentration in supernatant fractions.
 Take a sample for gel analysis from the supernatant fraction (10-20 g of total protein).
Take the same volume of the pellet suspension. Run gel and analyse distribution of TP
between pellet and supernatant fraction.
 In the best case, the TP would be found in the supernatant fraction at pH 5.5 and many
contaminations would be precipitated.
 Consider pH 5.5 for cation exchange chromatography (CEC) and go to step 20. If the TP
is precipitated at pH 5.5 go to DC(3).
33
20. Prepare sample for cation exchange chromatography(CEC)
 Dialyse whole flow-through fraction against 0.5-1 litre of buffer C (starting buffer,
20mM NaAc pH 5.5), change to fresh buffer after 2-3 hours and leave overnight.
 Check pH in the sample, and consider another 3-4 hours dialysis with fresh buffer if
the right pH has not been reached or adjust pH by addition of diluted acetic acid.
 Clarify protein sample by centrifugation (45000-70000g rpm for 10 min).
 Check volume and protein concentration and perform CEC as described in 22.
 Check protein concentration in flow-through fraction to find out if the TP binds to
the column.
o If most of the protein is found in flow-through fraction, go to DC(3).
o If there is significant binding, elute protein by 10CV of gradient 0 to 1M NaCl in
buffer C.
o Check protein concentration in fractions and run SDS-PAGE. On the gel there
should be represented: sample before dialysis, pellet obtained after clarification
of the sample after dialysis, sample applied on the column, unbound fraction
and protein containing fractions obtained after chromatography.
 If TP is revealed in the fractions and is pure enough – go to F,
 if it is not pure enough, go to step 21.
21. SEC. Concentrate protein on a Viva Spin concentrator to 1-2ml. Run SEC in the "standard
buffer". Perform SEC as in step 17
BLOCK VII. Basic proteins.
22. Cation exchange chromatography.
Prepare CFE in 50mM MES-NaOH pH 6-6.5 and proceed as for acidic proteins, but use SP-
Toyopearl, CM-Toyopearl or SP-Sepharose columns instead of DEAE-Sepharose column.
With AKTA use SP-HP cartridge(s).
Be aware that basic proteins sometimes fail to bind to cation exchange columns with no apparent
reason. In this case handle them as neutral proteins.
If protein binds to the column, elute it with an appropriate NaCl gradient (0-1M in 10 CV).
Usually the optimisation of the gradient is required for the best purification.
Purity of the TP most likely could be high enough to consider SEC as a final step to obtain pure
TP even if initial expression level was not very high.
23. Run SEC in the standard buffer or alternatively consider a buffer that is at least 1 pH unit
lower or higher than pI and has 0.15-0.5M NaCl. Try 50mM MES pH 6.5, 0.5M NaCl.

DC. Difficult cases.

1. The TP is not pure after three chromatography steps.


Consider a fourth step.
 If there is a FPLC system available, try Resource Q (Mono Q or any other anion exchange
column) for acidic proteins and Resource S (Mono S or analogues) for basic proteins.
o Prepare sample in a low salt buffer by dialysis, diafiltration or dilution.
o First perform a test run with 10-20% of the sample.
o For the test run consider a 10 CV gradient of NaCl from 0 to 1M in 50mM MES pH
6.5 for both acidic and basic proteins.
o Collect fractions of 40-50% of CV.
o Check protein concentration in peak fractions.
o Run gel to see what level of purification has been achieved.
 If you are not happy with the result, optimise gradient by choosing appropriate start and
final salt concentrations as well as slope of the gradient. Typically, start NaCl
concentration should be 0.1M lower and finish concentration 0.1M higher than the TP
elution point and the gradient length should be 10-15CV. Alternatively try different pH.

34
 If there is no FPLC system, use low pressure equipment. Try anion exchange
chromatography on a DEAE-Toyopearl 650S column or a Q-Sepharose column in buffer
A. Also, you can change pH and run chromatography on either of the anion exchange
columns at a lower pH. 50mM MES-NaOH pH 6.5 can be considered. For basic proteins
increase pH to 7-7.5. Do not discard flow-through fraction as there is a high possibility
that protein will not bind to the column.
 If protein is still not pure (and you haven’t actually lost all of it by this point!) further
options are FPLC HIC, chromatofocusing, preparative PAGE etc. In all my 25 year
practice there has not been a single protein which needed a fifth purification step.
2. TP has not been revealed after HIC. There are two ways to go:
 The first way is to do a second ion-exchange chromatography, as described above
(DC 1).
 The second way is to try a different type of HIC.
o Take 10-20% of the sample for the tests.
o The options are:
 use an Ethyl-Toyopearl column instead of Phenyl-Toyopearl;
 Use 2M KCl in buffer A as a loading and starting buffer on a Phenyl-
Toyopearl column or on a Butyl-Toyopearl column. The risk of losing the TP
on above columns is high, but if the protein is bound and eluted from them
successfully, there is a high chance of achieving a good purification.
3. TP precipitates with less than 1.5M AS or
basic TP precipitates with pH 5.5 or
TP does not bind to any column
This most likely means that TP is associated with small pieces of debris which are small
enough to stay in the supernatant fraction during CFE clarification. Only particles smaller
than 2MDa can enter the beads and be bound. If there is a significant insoluble component
of the TP revealed in the solubility test this is another sign that, despite the appearance of TP
as a soluble protein in the CFE, in reality the TP was expressed as an insoluble one. Try to
optimise growth condition during TP expression or try refolding from the inclusive bodies.
However there is small chance that the TP is one of rare proteins which reversibly precipitates
with 1.5M AS. In this case you should be able to dissolve it in 1-2ml of buffer A, clarify by
centrifugation and perform gel filtration.

F. Finish.
Congratulations, you have now got a purified protein.
Run a gel to analyse purification step by step.
Present on the gel should be:
MW markers, CFE, samples after each purification step and all pellets and supernatant
fractions which were obtained during purification. Take 15-20µg of total protein per
sample.
Analyse the gel pattern and work out the optimal purification protocol for the TP.

Prepare protein for use. I strongly recommend using freshly purified protein when and
where it is practical and possible.
For example: concentrate protein to 10mg/ml, change buffer to low salt 10mM tris –HCl
pH 8.0 or 50mM NaCl using diafiltration cup on VivaSpin or using desalting spin columns
(eg Zeba columns, Pierce) and use it for crystallisation on the same or next day.

Alternatively consider how the pure TP should be stored. (See Appendix1.3).

35
Brief scheme of purification of soluble protein
Cell paste with over expressed TP

Suspend in appropriate buffer ↓ 50 mM buffer pH 8.0
Disruption (sonication or French-Press) ↓
Spin down debris ↓ Centrifugation 45000-70000 g, 10-15 min.

Crude extract

Ion exchange chromatography
anion exchange for acidic protein (column with DEAE-Sepharose or Q-Sepharose)
cation exchange for basic proteins (column CM-Sepharose or SP- Sepharose)

analysis of elution profile (Bradford, activity, SDS-PAGE), pooling of fractions containing TP

Ammonium sulphate precipitation analytical trial

Protein precipitates with lower Protein precipitates with higher


than 2M AmSO4 than 2M AmSO4
 
Precipitate protein with AmSO4 Hydrophobic chromatography
(using lowest possible concentration of AmSO4) TakePerform
about 25%
testof
HICthe. protein sample,
Collect precipitate by centrifugation and add 1.8 M elution
Analyse AmSO4profile
and runby small
SDS- sc
dissolve in small volume of buffer PAGE.
hydrophobic chromatography.

If TP revealed If TP is not revealed

Run full scale hydrophobic chromatography AmSO4 cut


Collect TP, concentrate using concentrator
or precipitate with AmSO4

Gel filtration
Run gel filtration in appropriate buffer
Analyse elution profile by SDS-PAGE

If purity is higher than 85% If purity is less than 85%


 
Prepare protein for use or storage
For example: Try Ion exchange
Concentrate protein using chromatography on a column with
concentrator and exchange buffer on different matrix at a different
the concentrator, spin column pH or HPLC column
or by dialysis to low salt

Crystallisation trials
36
Timing for refined purification protocol
for soluble over expressed protein

Preparation of the crude extract (CFE) 0.5-1 hour



Ion-exchange chromatography on
DEAE-Sepharose Fast Flow 1 hour

SDS-PAGE (optional) s 1-1.5 hours

Ammonium sulphate cut or preparation of sample for 0.5-1 hour
hydrophobic chromatography in 1.5M AmSO4

Hydrophobic chromatography 1-1.5 hours


Concentration on VivaSpin concentrators or
Ammonium sulphate precipitation for storage or
to prepare a sample for gel filtration 0.5-1hour

Gel filtration 1.5 hours



SDS-PAGE analysis 1.5 hours

Concentration and preparation for storage or use 1 hour

The whole procedure takes from 4 hours (for two step procedure)
to 8-10 hours (for a 3 step procedure with SDS-PAGE after first step)

37
Purification of DNA-binding proteins

DNA-binding proteins have a number of specific feathers:


 As a rule they have affinity to Heparin
 As a rule they are not tolerate low salt conditions and can reversibly or sometimes
irreversibly precipitate in buffer A.
 Sometimes when cells are disrupted DNA-binding protein could stay bound to DNA.
According to my practice majority of DNA-binding proteins (at least major part of a pool)
actually do not bind to DNA. So, the most useful protocol is as follows:
 Destroy cells in buffer A containing 0.1M NaCl
 Apply on a Heparin column (Heparin-HP cartridge for AKTA system) and elute with 10
column volumes of NaCl concentration from 0.1 to 1-2M NaCl
o Most likely TP is bound and elutes with 0.3-0.8M NaCl. Run gel to analyse purity of
TP in peak fractions.
 If purity is high enough, the second step is gel filtration
 Alternatively apply IEC (preferably on FPLC column).
 Specific chromatography on Phospho-cellulose (or Phospho-Cellufine (CHISSO
Corp. Japan) were found to give good purification for some of DNA-binding
proteins
o If all or significant of TP is found in flow through fraction most likely it is bound to
DNA. In this case use alternative protocol

If majority of TP is bound to DNA the protocol is as follows:


 Cells should be suspended and disrupted in a buffer favourable for the DNase activity,
(50mM tris-HCl, pH 7.5-8.0, 4-5mM MgCl2). Add 5µg of DNase I per millilitre of cell
suspension. Alternatively you can use Bensonase. You may found that some time is
required to release TP from DNA. Incubate CFE overnight at 4oC for the best result.
 However, if the protein is being purified to be used with DNA, DNase treatment should
be avoided and cell paste disruption should be performed in 50mM tris-HCl buffer with
0.5-1.0M NaCl.
 In some cases ammonium sulphate cut was found useful as a first step of purification if
the TP precipitates with less than 2M of Ammonium sulphate. It may separate protein
from DNA and also give some purification. Precipitated TP is dissolved in buffer A and
then purified by Heparin chromatography.
 If AS cut is not applied, add 1/10-1/5 of sample volume of 5M NaCl to bring salt
concentration in the homogenate to 0.5-1.0M before centrifugation.
 Dilute CFE to bring salt to 0.1-0.2M and apply on Heparin column.
 Use gel filtration or IEC or both for further purification

For some DNA binding proteins it was found very effective to use big difference in solubility at
different salt concentration.
 Cells can be destroyed in Buffer A and after centrifugation TP is found in the pellet.
 Then it can be extracted using 1M NaCl.
 Next step could be AS cut
 Further purification is performed by gel filtration or Heparin chromatography.

38
Protocol 1
CFE prepared in buffer A+0.1M NaCl

Heparin chromatography
Ammonium sulphate cut
Gel filtration or IEC

Protocol 2
Disruption by sonication in buffer 50 mM tris-HCl pH 8.0,
4mM MgCl2, (1mM DTT), 5µg/ ml Dnase I or bensonase

Spin down debris

Incubate over night

Ammonium sulphate cut


Heparin-Sepharose
Chromatography
Desalting by dialysis or fast gel
filtration or dilution to appropriate
salt concentration
Gel filtration or
IEC

P-Cellufine Chromatography

Final preparation

39
Protein purification statistics

40
IV. Protocols
1. Protocol for preparation of the stock solution
Salts stocks preparation
1. Take a 1 litre glass beaker with a big magnetic follower bar and pour in the weight of
salt powder that is required.
To prepare 1litre of 1M solution of any substance take amount in grams equal to its
MW.
For 5M NaCl weight 292g. For 4M Ammonium sulphate weight 528g.
2. Pour ultra pure water into the beaker to approximately the 900-950ml mark.
3. Place on a stirrer and switch on. At the start you should help the magnet to start rotating by
stirring the slurry with a rod or a spatula.
4. When the salt has dissolved pour the solution into a 1 litre volumetric flask.
 To make sure all the salt has been washed into the flask, rinse the beaker with 2-3 small
volumes of ultra pure water and add them to the flask.
 Make the volume up to the 1 litre mark with additional ultra pure water.
You may have a problem with dissolving all the ammonium sulphate because 4M is close to
the saturation point. To encourage dissolving, you can gently heat the mixture up to 40-
50oC under constant control (to prevent overheating). Alternatively you can wait until most
of the salt is dissolved, switch the stirrer off and gently pour the clear solution in to the
volumetric flask. Add a little bit of ultra pure water to the rest of the salt in the beaker, stir
it briefly and add any clear solution to the volumetric flask. Do this 2-3 times until all the
salt has dissolved. Be careful not to exceed 1 litre!!!
4. Filtrate solution through a 0.22mfilter using Filter Holder with Cellulose Nitrate Whatman
filter or Stericup Filter Unit connected to a vacuum pump. Always wet the membrane with
a few drops of ultra pure water before you start filtration.
Using the vacuum pump wash Filter Holder’s porous disk with plenty of grey tap water
immediately after use to prevent salt crystallising in the pores and therefore blocking the
filter.
5. Pour solution into a clean bottle. Write the date and your initials on it.
6. For a control measure, check the refraction of the solution. For 4M (NH4)2SO4, it should be
37% and for 5M NaCl it should be 28% on a sugar refractometer.

Buffers stocks preparation


1. Weight required amount of buffer powder in to 1litre glass beaker with the magnet in.
For 1M solutions take Tris-121g, MES- 195g, HEPES-238g.
Add ultra pure water to about 600-700ml and place beaker on the stirrer next to pH meter.
2. To adjust pH in MES and HEPES solutions use 5M NaOH or 5M KOH solutions. When pH
is OK, adjust volume to 1 litre using volumetric flask and filtrate solution through 0.22m
filter.
To adjust pH in Tris buffer place the beaker with the solution in to the ice-water bath and
on the stirrer next to pH meter preferably under fume hood. Deepen pH probe and
thermometer in the solution. Use concentrated HCl for titration. Take care, wear gloves and
do not inhale fumes. First adjust pH to about 9. Wait while temperature droops to 20˚C and
continue to add acid slower. Finally it should be desirable pH (usually 8.0 or 8.5) at 20˚C.
3. Proceed with adjusting volume and filtration.

41
2. Protocol for quick and effective cell disruption
and preparation of the crude extract (cell free extract)
1. Cell harvesting
 Spin down cells first in the big bottles
 Re-suspend pellets in about 50 ml of culture medium, place in a 50 ml Falcon tube and
spin down for 10-15 min at 5000 rpm.
 Remove medium and put tube with cell pellet in to the -20C or -70C freezer.
Alternatively suspend cells in Lysis buffer (see p16) (5-10 ml per gram of cell paste), pour
into a Falcon tube and put it in to the freezer.
Remember to use Virkon for decontamination of discarded medium
2. On the day of protein purification:
 take cell paste from the freezer, add 8-15 ml of lysis buffer (e.g. Buffer A) per gram (ml)
of cell paste
 let it thaw for 5 minutes, briefly suspend cell paste with spatula
 divide suspension into 10-15 ml portions placing them into 20 ml plastic vials using a
plastic pipette . If there is small amount of cell paste (1g or less) you may use small 5 ml
containers to place 3-4 ml of cell suspension in each.
 Place vials on an ice bath.
Tip: for more effective cooling put small pieces of ice into the vials.
If cells were frozen with buffer, for quick defrosting place tube in to warm water or hold under
a hot water tap, mixing by tipping upside down until it thaws. Then divide into portions as
above.
3. Before you start sonication, put rotor (JA-20 or JA-25.50) into the Avanti centrifuge, close
the lid and set pre-cooling at 4C
4. Mount medium probe on a Soniprep 150 machine. Tighten it properly with the tool, but do
not over-force.
 Lower probe into the vial with the sample, leaving 2mm between the probe and the
bottom of the vial; the probe should not touch the bottom of the vial but neither should it
be close to the surface of the sample. If the probe is too close to the surface, foam will
form, this should be prevented to avoid oxidation and denaturing of proteins.
5. Set sonicator for maximum force. This corresponds to 16 micron amplitude.
6. Sonicate portions one after another for 20 seconds each. Carry out 2-4 cycles without a
break. The samples will cool down while you treat other portions. If you use small (5ml)
containers, treatment should last for 8 seconds. If you have got just two portions to treat,
be more careful and put ice pieces into containers between the sonication cycles.
If power does not reach 16 micron, try reattaching the probe (tighten it more).
7. After completion of sonication unscrew the probe, wash it with distilled water and dry with
tissue. Place back in the box.
8. Pour homogenate in to the centrifugation tubes, balance them and spin down in JA-20 or
JA-25.50 rotor at 4C
 for JA-20 rotor in J-20 centrifuge set 19000 rpm
(about 43000g) for 15 minutes
 for JA-25.5 rotor in J-25 Avanti centrifuge set 24000 rpm
(about 70000g) for 10 min
9. Once centrifugation has finished pour supernatant fraction into the cylinder (if you use
peristaltic pump for chromatography) or in the beaker (for AKTA system application) and
keep it cold. Check volume. Check protein concentration (see protocol for Bradford assay in
Appendix). Calculate total protein.
The Crude extract (Cell Free Extract) is now ready for the next step.
42
3. Protocol for protamin sulphate (PS) treatment
1. Measure volume of the crude extract
2. Calculate an amount of protamin sulphate taking 2mg for each ml of the crude extract, weigh
this amount into an eppendorf tube and suspend it in 1 ml of water. It takes a long time for
protamin sulphate to dissolve, so do not wait and use the suspension instead.
3. Place a beaker with the crude extract into an ice bath or in the cold cabinet or cold room at
4ºC on a stirrer and set one to an appropriate speed (the vortex should appear in the middle
of the beaker).
4. Add protamin sulphate suspension drop by drop. Stir for about 10 minutes.
5. Spin down precipitate at 40000g for 15 minutes or at 70000g for 10 minutes.
6. Recover supernatant fraction, check volume and protein concentration.

4.3. Protocol for analytical ammonium sulphate cut (AS cut)


1. Take six 1.5ml eppendorf tubes and mark them as follows:
(I) 1.5M pellet, (II) 2.0M pellet, (III) 2.5M pellet,(IV) 3.0M pellet, (V) 3.5M pellet,
(II) (VI) 3.5M supernatant.
2. Add 0.3ml of 4M AS solution in the tube (I) and 0.2ml in the tube (II). Weight 66mg of AS
powder into each of tubes (III), (IV) and (V), leave tube (VI) empty.
3. Place 0.5 ml of the cold crude extract in tube (I) and mix by pipetting in and out. Leave for
10 minutes on ice. Spin down for 2 min in the bench centrifuge (13000rpm) or, better still,
in a refrigerated centrifuge. Carefully take out supernatant fraction and add it into the tube
(II).
4. Repeat the above operation with tube (II), then tubes (III), (IV) and (V). Each time dissolve
AS powder in the supernatant fraction from the previous tube, incubate on ice and spin
down the pellet. Last supernatant fraction goes to the tube (VI).
5. Add 0.1ml of Buffer A (50mM tris-HCl pH 8.0) into each of the tubes (I), (II), (III), (IV),
(V) and dissolve the pellets.
Check protein concentration in each tube, including tube (VI).
You will probably find a very low protein concentration in tube (VI) (the 3.5M supernatant
fraction).
6. Run gel to see which fractions contain the target protein. Take equal volumes from all
fractions to prepare samples for the gel. You may have a problem with 3.5M supernatant
fraction as it will have a very high AS concentration and low protein concentration. If you
recover less than 10% of total protein from this fraction it is best to exclude it from the
analysis. If there is a significant amount of protein, dilute it 4 fold with buffer A and
concentrate to 0.1 ml using VivaSpin6 concentrator.
7. Analyse the pattern on the gel and develop preparative AS cut strategy.

5. 4. Protocol for preparative ammonium sulphate cut


1. Pour protein solution or crude extract in to a beaker with a magnetic bar in it. Choose a
beaker volume 2.5-3 times larger than the volume of the sample.
2. Place beaker on ice (or at 4˚C) and on the stirrer. Set stirrer to mix solution with a speed
which allows a vortex to form in the middle of the sample.
3. If the first precipitating concentration is 2M ammonium sulphate (50% saturation) or lower
(this would be found during the analytical experiment), use 4M AS stock solution to bring
the sample up to the desirable AS concentration. This is a much gentler way than using
powder. Calculate the volume of the 4M AS solution needed and add it to the beaker. Stop
stirrer and incubate for 15 minutes.
4. Spin down pellets in JA-20 or JA-25.50 rotor at 19000 rpm for 10 minutes.
43
5. Measure the volume of the supernatant fraction and pour it back into the beaker that is on
the stirrer (in ice bath or at 4˚C). Check protein concentration to control the process.
6. Using table (see Charts and Tables), work out the amount of AS powder that is needed to
precipitate the target protein.
7. Weigh out the required amount of powder and add it to the sample (with stirring) in small
portions, allow previous portion to dissolve before the next one is added. When all the salt
has dissolved, turn off stirrer and leave sample for 15-30 minutes.
8. Collect pellets by centrifugation as above, remove supernatant fraction completely and
dissolve protein pellet in the appropriate buffer. Check volume and protein concentration in
the sample.
Remember that precipitation of protein depends on precipitant as well as protein concentration.
Carry out the preparative and analytical experiments using the same protein concentration.
NOTE: a significant concentration of AS is still present in the sample!

6.5. Protocol for precipitation of proteins using ammonium sulphate


1. Measure the volume of the protein solution, pour it into a beaker with a magnet bar and place
it in an ice bath or at 4oC on a stirrer.
2. Calculate the required amount of ammonium sulphate, taking 0.6 grams of salt per millilitre
of the protein solution and weigh the amount out.
3. Start stirring the solution and add salt to it in small portions, allow salt to dissolve before
adding the next portion.
4. When all the salt has been added take beaker off stirrer and leave it at 4 oC for some time,
ideally overnight.
As a rule, you can store protein this way for a very long time.

7.6. Recovery of protein from the ammonium sulphate precipitate

1. Place an appropriate volume of the ammonium sulphate precipitate suspension into a


centrifugation tube.
2. Collect precipitate by centrifugation at 45000 g for 5 min at 4oC.
3. Remove supernatant fraction carefully, try to take out every last drop of ammonium sulphate
solution.
4. Re-suspend pellet in a small volume of appropriate buffer and dialyse it against some 10-100
volumes of buffer. Make 2-3 changes, the last one should be left overnight for full
equilibration. After 2 changes you can expect there to be about 1-2mM of ammonium
sulphate left in the sample, with 3 changes it is close to 0. As an alternative to dialysis you
can use desalting columns.
5. It is useful to clarify sample from possible insoluble contaminants by centrifugation at
25000g or higher for 15 min.

Remember that some proteins can not be recovered from ammonium sulphate
precipitate

44
8. Analysis of solubility of expression
A. “Bug buster” method
Preparation of the solutions:
Reagent A: BugBuster Protein extraction Reagent from Novagen
Reagent B: Benzonase Nuclease (product 70746 from Novagen), 25u/μl, 0.2ml.
 Divide this 0.2ml sample in to 20x10μl portions in 0.5ml eppendorf tubes. Store at -
20˚C (not -70˚C).
 Prepare 4ml of the buffer 50mM tris-HCl pH 8.0, 20mM NaCl, 5mM MgCl2, 20%
glycerol and make 20x190μl aliquots in 0.5ml tubes, keep them frozen at -20˚C.
 Prepare working solution: Take buffer from the one tube and add it into the tube
with 10μl of benzonase making 20 fold dilution). Make 50x4μl aliquots in 0.5ml
tubes and store them at -20˚C. Mark these tubes "reagent B".
Method:
1. Take one tube of reagent B from the freezer and add 0.1 ml of reagent A (stored at room
temp.)
2. Prepare about 20 μl of cell paste pellet in a 1.5ml tube. To get this, spin down 1-1.5 ml of
culture or take a bit of frozen cell paste.
3. Add 0.1 ml of reagent A+B to the cell paste. Suspend it properly using a small plastic rod.
Do not pipet up and down to avoid bubbles.
4. Place on a rotating platform and incubate for 10 min.
5. Spin down debris at 20000g for 5-10 min in the refrigerated centrifuge.
6. Take out supernatant and place into another tube. Mark it ‘S’
7. Add 0.1 ml of 2% SDS solution to the tube with pellet and suspend it properly with a rod.
Mark it ‘P’.
B. Sonication method
1. Suspend 30-50 µl of cell paste in 0.3-0.5ml of Buffer A in 1.5 ml eppendorf. Place on ice.
2. Using thin probe apply sonication at 16 micron amplitude for 2-3 sec. It is most convenient
to hold tube in hand to control temperature to avoid overheating. Place tube on ice for 20sec
to cool down.
3. Repeat sonication 3-4 times.
4. Spin down debris in the refrigerated centrifuge at 4oC, for 10 min, at 20000g.
5. Separate supernatant fraction into another tube (mark it ‘S’).
6. Re-suspend pellet in equal volume of water or buffer or 2% SDS (mark tube with ‘P’).
For DNA-binding proteins for sonication take buffer:
1M NaCl, 50 mM tris-HCl pH 8.0 or use Alternative way:
Re-suspend debris pellet in 0.1 ml of 50 mM tris pH 8.0, 1M NaCl,
Spin down pellet as above.
Separate supernatant fraction in to a clean tube. Mark tube S1.
Re-suspend pellet in water or SDS as above (tube P).
SDS-PAGE analysis
1. Check protein concentration in supernatant fraction (tube S) and in tube S1 (if applicable)
2. To prepare a “Soluble proteins” sample take about 20 g of total protein from tube S for
a sample for gel, add water to make total volume 15µl if necessary. Take approx 10g of
protein from tube S1 if there is any noticeable protein concentration.
3. To prepare “Insoluble proteins” sample take the same volume from the tube P as you took
from tube S for a sample for gel, add extra SDS (10% solution) so as to make the SDS
concentration about 4%.
4. Preheat dry block to 100oC or make bath with the boiling water.
5. Add 4x-Sample Buffer and 10x-Reducing agent (both from Invirogen) to the samples and
boil them for 2 min. Apply on a gel. To make your gel more informative place pre-induction
cells sample prepared the same way as over-expressed cells sample.

45
9. Analysis of expression for low expressed His tagged protein

1. Prepare CFE in BufferA+0.5M NaCl (0.5M NaCl 50mM trisHCl pH 8.0)


2. Using yellow tip with cut off end take 50µl of 50% Ni beads suspension in to 0.5 or
1.5ml eppendorf (depends on volume of CFE you are going to use).
3. Wash beads with above buffer :
 Spin down beads at 1000g (preferably in swing out rotor) for 1min and remove
liquid.
 Add buffer to fill the tube, spin beads down
 Remove liquid carefully , do not touch beads , leave a little bit of buffer above
them
4. Add CFE to the tube to fill the tube to top.
5. Incubate on wheal in the cold cabinet for 0.5-1hour.
6. Spin down beads and take supernatant fraction in to the new tube (Unbound material)
7. Wash beads to remove traces of unbound material:
 Fill tube with buffer. Realise buffer from the tip aggressively, so all beads are
moved. Mix gently by reversing tube, do not vortex.
 Spin down and remove supernatant fraction. Be careful do not take beads, leave a
little bit buffer above them.
 Repeat wash, but this time try to take out as much buffer as possible. Use gel
loading tip to take the last portion of buffer from the beads. Still be very careful,
do not allow any beads in to the tip.
8. Elute protein from the beads:
 Add 50µl of 1M Imidazole in above buffer (1M Imidazole, 0.5M NaCl, 50mM
tris pH 8.0)
 Mix very gently with “cut off end” yellow tip. Some of the beads will be left in
the tip, it is OK, ignore them.
 Spin down beads. It is not necessary to take supernatant fraction out.
9. Analysis by SDS-PAGE
 Check protein concentration in the eluate. Take 10µl for Bio-Rad assay.
 Take 10-15µg of eluate for the SDS-PAGS sample. If protein concentration is
low, take 25µl of the eluate.
 Take 10-15µg of CFE and equal volume from Unbound material to make SDS-
PAGE samples.
 Run gel : Mark12, CFE, unbound, eluate

46
10. Bio-Rad protein assay protocol
Bradford Method
(Sveta’s adaptation of the Bio-Rad micro assay procedure)
1. Into a plastic cuvette (1.6 ml volume) place 1-20 µl of protein solution, containing
approximately 1-10 µg of protein
2. Add 0.8 ml of ultra pure water and 0.2 ml of Bio-Rad Dye Reagent Concentrate
3. Seal cuvette with parafilm and mix carefully by tipping upside down and right way up
again.
4. Measure OD 595 . It should be between 0.1 and 0.7.
If readings are higher, dilute protein solution or take smaller volume, if they are lower,
increase volume of protein solution taken for test and decrease the volume of water
accordingly to keep total volume of test within 1 ml.
5. Calculate Protein concentration using formula:

OD 595 x 15
--------------------------- = protein concentration (mg/ml)
volume of protein (µl)

Usually while monitoring protein concentration during purification we do not need high
accuracy, but still be careful in aliquot handling and pipetting especially when you take
small aliquots. I would not recommend you to take less than a 1μl sample. When taking
1μl, always check amount of liquid in the tip and remove any liquid attached to the outside
surface of the tip. After pipetting sample out make sure that the tip is empty. Do two
repetitions and if difference between them is more then 10%, repeat it again!

11. 7. Protocol for accurate determination of concentration


of pure protein
1. Place 1ml of 6M GuHCl, 20 mM NaP, pH 6.5 into a quartz cuvette and zero it at 280 nm
on a spectrophotometer.
2. Add 10-50 µl of protein solution containing about 0.1- 0.3 mg of the target protein into
the same cuvette, seal with parafilm and mix by tipping upside down. Take measurement
at 280nm. For a reliable result the reading should be between 0.1 and 1.
3. Calculate concentration of protein using Abs 0.1% (1mg/ml) (this is given in the
ProtParam data in Expasy data base for your protein). Multiply by dilution factor.
4. Using the same protein solution make a calibration plot for Bradford (Bio-Rad) assay
and calculate accurate factor which you can then use for accurate determination of
concentration for this protein by the Bradford method.
5. Place 1ml of appropriate buffer (for example Buffer A, PBS or Buffer A+0.1M-0.5M
NaCl) into a quartz cuvette and zero it in the range 240-340nm. In the same cuvette add
the same volume of the protein solution as in step 2 and take spectrum from 240 to 340nm.
If there is no significant light scattering between 300 and 340nm (absorption is close to 0),
calculate the extinction coefficient (at 280nm or at maximum) for the target protein under
non-denaturing conditions (in the given buffer) (see Appendix for details).

47
12. Calibration plot for gel filtration column
1. Find suitable proteins to cover MW from 500kDa to 5kDa. Apart of proteins listed in the
LMW and HMW kits (GE Healthcare) the following proteins may be suggested:
Glutamate Dehydrogenase (330kDa), Catalase (250kda), , Amylase (200kDa), Alcohol
Dehydrogenase (150kDa), Bovine albumin (66kDa), Trypsin inhibitor (20.1kDa),
Cytochome C (12.3kDa), insulin (5.8kDa).
2. Chose set of 4 proteins with MW differs from each other 2-3 fold. Say, Catalase, Bovine
albumin, Trypsin inhibitor, insulin. Or GluDH, AlhDH, Ovalbumin, Cytochome C and so
on.
3. Balance about 10mg of each protein in to 1.5ml tubes and dissolve in 1ml of buffer
50mM tris pH 8.0, 0.1M NaCl.
4. Take optical density at 280nm for each protein. In order to do it make 0.8ml of 10 fold
dilutions (0.72ml buffer+0.08ml protein solution) and take measurements in the 1ml
quartz cuvette. Alternatively use NanoDrop or Nanophotometer.
5. Calculate volume of each protein corresponding to 1optical unit, take corresponding
volume of each protein and mix it in the new tube. For example: 280nm density was: for
protein 1- 6ou/ml, for protein 2 - 8ou/ml, for protein 3 - 10ou/ml, for protein 4 - 4.5ou/ml.
To make a mix take 0.167ml of protein 1, 0.125ml of protein 2, 0.1ml of protein 3,
0.22ml protein 4.
6. Make volume of the mix to 1-2ml and apply on a column (1.6x60cm HiLoad Superdex).
Run gel filtration at the same flow rate and in the same buffer as for an experimental
protein. For smaller or bigger columns adjust amount of proteins accordingly
( 0.25ou/protein for 1x30cm Superdex columns or 2.5ou/protein for 2.6x60cm columns)
7. Carefully measure elution volume (Ve) of each peak. If you use a peristaltic pump and a
pen-paper recorder it is important to measure the actual flow rate carefully in order to get
accurate Ve values.
8. To make calibration plot you also have to know void volume Vo and total column
volume Vt. For total volume take height of the column bed in cm, multiply by cross area
of the column) For 1.6x60 Hi-LoadSuperdex200 column normally total column volume
equals 120ml. To find Vo run separate run of Blue dextran. Apply 2-3 optical units at
280nm and take elution volume of the first peak as a Vo. For 1.6x60 Hi-LoadSuperdex200
this value typically is around 45ml. This value is rather stable; do not check it each time
unless the column size was changed (as a result of a drying event or cleaning of the top of
the column).
9. For full and more accurate calibration run 2 sets of different proteins.
10. Make plot KAV=(Ve-Vo)/(Vt-Vo) versus logMW. The another way to plot results may be
logMW versus Ve/Vo. Both give you a linear plot, but latter version is not used nowadays.

13. Ni-chelating cartridges: cleaning and recharging


To recharge Ni-chelating cartridge wash it using syringe:
1. with 5 volumes of ultra pure water
2. with 5 volumes of 0.2M EDTA
3. with 5volumes of ultra pure water
4. with 5 volumes of 0.1M NiSO4 or NiCl2 or 0.3 volumes of 1M Ni salt
5. with 5volumes of ultra pure water
6. with 5 volumes of the starting buffer.
Clean cartridge when flow rate have noticeably decreased.
 Try to wash column with at least 2 volumes of 0.2M EDTA and 2 volumes of ultra pure
water
 Find the set of adapters and connectors to connect syringe to the bottom of the cartridge
 Fill syringe with 1M NaOH, connect it to the bottom of the cartridge carefully, do not allow
air into the cartridge and wash it with at least 2 volumes of 1M NaOH. When cartridge is
48
blocked with the dirt it is not easy to push liquid trough it. Be patient, take your time, do not
push too hard.
 Wash cartridge with at least 2 volumes of ultra pure water
 Apply syringe on the top of the cartridge and wash with at least 1 volume of 1M
NaAcetate pH 4.0. At this point flow rate most likely to be significantly increased.
 Wash cartridge with 5 volumes of ultra pure water and charge with Ni.

14. SDS PAGE (Laemmli, Nature, 1970, 227, 680-685)


Sveta’s easy protocol
Stock solutions:
1) 1.5 M tris-HCl, pH 8.8
2) 1.0 M tris-HCl, pH 6.8
3) Acrylamide 30% : (30g acrylamide, 0.8g bisAA per 100ml).
Use ready made solution (better) or make from solid reagents
4) Acrylamide 20% (30% solution diluted 1.5 fold with H2O)
5) Persulphate ammonium 10% (freshly made)
6) SDS 10%
7) TEMED
10 X Running Buffer: 144 g Glycine, 30g tris, 10g SDS.
For a run dilute 10 fold with distilled water.
pH is 8.3, do not adjust !!!
Sample buffer:
for 20 ml of 5x buffer:
6.25 ml 1M tris pH 6.8, 2g SDS, 5g sucrose, 1mg bromphenol blue, water to 18 ml.
Before use, add 0.1 ml of 0.5M DTT to 0.9 ml of
buffer for reducing conditions.
It is better to use ready made 4x sample buffer and 10x reducing agent from
Invitrogen ( now Life technologies) .
Gel preparation:

separation gels (for 8ml) stacking gel 5%


component 7.5% 10% 12.5% 15% (for 4ml)
1.5M tris pH 2ml 2ml 2ml 2ml -
8.8
AA 30% - - 2ml 4ml -
AA 20% 2ml 4ml 2ml - 1ml
H2O 4ml 2ml 2ml 2ml 2.5ml
SDS 10% 80μl/ 80μl 80μl 80μl 40μl
TEMED 10-20μl 10-20μl 10-20μl 10-20μl 10-20μl
PSA 10% 40μl 40μl 40μl 40μl 20μl
1M tris pH 0.5ml
6.8

49
15. DTNB reaction
Reagents:
bufferN: 0.1M Na phosphate , 1mM EDTA pH 7.3
bufferG: 6M GuHCl, 0.1M Na Phosphate, 1mM EDTA pH 7.3
DTNB reagent: 10mM in bufferN
Reaction:
1. Take 0.9ml of bufferN or bufferG in cuvette and add 0.1ml of DTNB reagent. Mix and
use the cuvette to blank spectrophotometer at 412nm.
2. To the cuvette add 10-50ul of the protein solution (0.5-1mM), mix, incubate for 1-2
minutes and take measurement at 412nm.
3. Calculations:
A412/0.0136 = concentration of TNB in µM
(concentration of TNB in µM) / (concentration of protein in µM)= SH groups/protein molecule
Make 2-3 protein concentrations

16. Refolding protocol


Buffers:
Buffer R : 40 mM tris-HCl pH 8.0, 1 mM EDTA, 1M NaCl.
Buffer U: 8M Urea, 50 mM DTT, 2 mM EDTA, 40 mM Tris-HCl pH 8.0.
Make about 20 ml of buffer U, take urea and DTT as a powder, EDTA and Tris as a stock
solutions. Filtrate with 0.22µ filter, keep rest of buffer at -20°C.
Procedure:
1. Resuspend cell pellets in about 10-20 volumes of Buffer R
2. Sonicate on ice 3x20sec at maximum, as usual.
4. Centrifugate 10000 g for 10 min., remove supernatant fraction ( do not discard, keep and
analyse on gel to be sure, that there was no any soluble target protein).
5. Resuspend pellets in about 5 volumes of Buffer R, for better result sonicate it briefly.
Spin down at 10000 g for 5 min, discard supernatant. Repeat the same procedure once again.
6. Resuspend pellets in about 3 volumes of Buffer U. Place small magnetic bar in the tube and
stir for 1h at room temperature or over night at 4oC
7. Spin down at 40000 g -70000 g for 10 min. Check protein concentration. Calculate amount
of protein.
8. Dilute supernatant 40 fold with buffer R. Spin down as above. Check protein concentration
again. Calculate amount of protein in solution.
If protein could not be refolded by this method, you, probably, can recover just tiny fraction of
protein in solution. In this case we need to think about another refolding conditions (you may
try to add substrate or cofactor or other appropriate ligand in buffer R).
If you can recover significant amount of protein (more than 20%) move ahead.
9. Concentrate protein on Viva Spin concentrator ( 10 000 MWCO) some 50-100 fold. Check
protein concentration and calculate amount of recovered protein. Once again you could have
problem here.
If it is not much protein recovered, so method does not work (bad luck).
If you have some 50% or more, it is good.
10. Run gel to analyse procedure. Put on gel: whole cells, supernatant (soluble proteins), pellets
(insoluble proteins) obtained after Urea extraction, Urea dissolved proteins, finally refolded
protein. Try to take 10µg of protein per sample. If concentration is low, try to concentrate it to
1-2 mg/ml (if possible).
11. If TP is revealed apply sample on gel filtration column to make sure that protein peak
appeared as a folded protein of a reasonable MW and not in the void volume as an aggregates
(in case if TP is not properly folded)

50
V. Charts and Tables

51
52
53
54
Calibration plot
Calibration plot forfor Superdex200
Hi-Load Superdex200
0.5M NaCl, 50mM tris-HCl pH 8.0
0.9

0.8

0.7

0.6

0.5
Kav

0.4

0.3

0.2

0.1

0
3.5 4 4.5 5 5.5 6
logMW

Kav=(Ve-Vo)/(Vt-Vo)=(Ve-45)/75
(for HiLoad 1.6x60cm column)

55
Calibration plot at various salt concentrations
Superdex 200 GL column
2.5

2.4

2.3

2.2

2.1

1.9
Ve/Vo

1.8

1.7

1.6

1.5

1.4

1.3

1.2

1.1
3.6 3.8 4 4.2 4.4 4.6 4.8 5 5.2 5.4 5.6 5.8
lgMW

0M NaCl 50mM NaCl


0.1MNaCl 0.5M=1M NaCl
Linear (0.5M=1M NaCl) Linear (0.1MNaCl)
Linear (50mM NaCl) Linear (0M NaCl)

56
57
Properties of amino acid residues

58
VI. Appendix 1
1. Determination of the protein concentration
There are two widely used ways to determine protein concentration.
 Firstly there are a number of colorimetric methods based on the formation of reagent-
protein coloured complexes. Most acknowledged are the Biuret method, Lowry method
and Bradford method. The latter method is most simple and so most suitable for protein
monitoring during purification.
 The second way is based on UV absorbance of the aromatic residues. Absorbance at
280nm is widely used. Also one can use absorbance at λmax which can be revealed by
taking a spectrum of the protein between 240nm and 340nm.

Bradford Method
This method is based on formation of Protein – Coomassie Brilliant Blue G-250 complex which
has maximum absorbance at 595 nm.
Advantages: Rapid, Simple,
Sensitive (small amount of protein required for test),
Highly compatible with most reagents and substances
Disadvantage: Significant protein to protein variations
Applications: Monitoring of protein concentration during purification
Determination of relative concentration of pure proteins
See Protocol section for Bio-Rad protein assay protocol, the adaptation of Bio-Rad micro
assay procedure, based on the Bradford method. Also read instruction enclosed with Bio-Rad
reagent.
In the protocol mentioned above incubation with reagent (normally 5 min) is skipped to save
more time during protein purification. The reason to do so is that about 90% of the coloured
complex is formed within one minute while you mix the reagents. This is applicable to the
majority of proteins, but some of them (1-2% from my experience) need more time to develop the
full colouring. The most extreme case was one of the Fab fragments which required 1 hour
incubation. Be aware of that when you start to work with the new TP.
Protein can be denatured to increase its reaction with the reagent.

Accurate determination of concentration of pure protein:


UV absorbance at 280 nm

The method is based on UV absorbance of aromatic residues in proteins.

Tryptophan ext. coefficient* at 279 nm 5579 M-1 cm-1

Tyrosine ext. coefficient* at 274 nm 1405 M-1 cm-1


Phenylalanine ext. coefficient* at 259 nm 195 M-1 cm-1
*Extinction coefficients are given for solutions in water
For each individual protein Extinction coefficient and Abs 0.1% (1mg/ml)
can be calculated from its amino acid composition.
Use ProtParam Tool program in Expasy database to do this.

59
Calculated extinction coefficient is given for fully unfolded protein in the presence of 6M Gu-
HCl. The reason for this is that hydrophobic surrounding of aromatic residues involved in core
of the folded protein leads to increasing of their extinction coefficient.

Advantages: High accuracy and Simplicity


Disadvantage: Requires relatively large amount of protein if use the standard cuvette
See Protocols section for: Protocol for accurate determination of concentration of pure
protein.
With the protein solution of known concentration (measured by above method) you could make
a calibration plot for the Bradford method for the target protein. So afterwards you can use the
Bradford method to measure concentration of the pure target protein accurately.
Also you can use the UV spectrum of the target protein solution in any appropriate non-
denaturing buffer for the determination of the protein concentration. The best range of
wavelength is from 240nm to 340nm. See typical spectra shown below.
There are two precautions should be taken when you use UV absorbance to estimate the protein
concentration
1. For many proteins coefficients of extinction at denaturing and non-denaturing conditions
are fairly close, but for some of them the difference could be significant. So you should compare
spectra taken from the target protein solutions prepared at the same concentration in both
denaturing and non-denaturing conditions and calculate the extinction coefficient under non-
denaturing conditions.
2. Also you should take into consideration that the result could be significantly over estimated
due to the contribution of light scattering on the possible protein aggregates. UV absorbance
between 300nm and 340nm is an indicator of the aggregates presence in the sample. The closer
it is to 0, the lower is the light scattering contribution. If the spectrum shows low absorbance
from 340nm to 300nm and a sharp increase in absorbance from 300nm to 280nm it can be used
to accurately calculate TP concentrations. Otherwise it is better to use alternative ways
(Bradford method or UV absorbance under denaturing conditions) because it is difficult to
deduct the light scattering component from the total absorbance accurately.
For example, looking at protein spectra below there is no doubt that the spectrum of the
tryptophan-free protein is suitable for accurate calculations. But you can see that the spectrum of
the tryptophan containing protein is not so irreproachable. It is still suitable for the calculations,
but one should deduct Abs at 320nm from Abs at 280nm to get more accurate result.

60
UV spectrum of the
tryptophan-free protein
The observed absorbance
corresponds mainly
to the tyrosine residues

UV spectrum of the
tryptophan containing
protein
The observed absorbance
corresponds to a
combination of the
tryptophan and the tyrosine
residues in the protein

UV spectrum of the protein


containing phenylalanine but
no tyrosine or tryptophan
The extremely rare example of
the protein with no Tyr or Trp,
FtsZ from [Link]
It is not possible to use
absorbance at 280nm to
determine its concentration

61
See example below for further explanation:
Spectra shown belong to FtsZ protein from Bacillus subtilis.
This protein has 2 tyrosines and 9 phenylalanines out of total 382 residues. This is why for this
protein the value of Abs 0.1% (1mg/ml) at 280nm is as low as 0.063.
The shape of the spectrum is unusual because of the visible contribution from the phenylalanine
absorbance which is normally hardly detectable. Also contribution from peptide bond
absorbance at 230nm makes significant contribution to the shape of the spectrum almost
eliminating the minimum at 250nm. As you can see without the deductions of underlined
absorbance in Spectrum 1, for protein in 10mM tris-HCl pH 8.0 error is just 8%, well within
acceptable for most of uses 10% level. For Spectrum 2 the error is high 21%. And if you
calculate protein concentration from A280 in Spectrum 3, you overestimate it at least 100%.

Spectrum 1.
This spectrum is taken from FtsZ in buffer
10mM tris-HCl pH 8.0
Light scattering is very low, however there is
some absorbance at 305nm which should be
deducted from absorbance at 280nm.
Abs280-Abs305=0.787-0.066=0.721
Conc=0.721/0.063=11.4mg/ml

Spectrum 2.
This is spectrum of FtsZ in buffer 50mM MES
pH 6.5, 0.2M NaCl.
This spectrum is still suitable for calculations,
light scattering is not too high, but base line
obviously is not zeroed properly. So once again
absorbance at 305nm should be deducted from
absorbance at 280nm
Abs280-Abs305=0.469-0.097=0.372
Conc=0.372/0.063=5.9mg/ml

Spectrum 3
Spectrum of FtsZ in buffer 10mM MES, 2mM
MgAc, 1mM EDTA
Significant light scattering on aggregates not only
affects value of absorbance at 280nm but also a
shape of the spectrum. This spectrum is
unsuitable for calculations

62
2. How to concentrate proteins

The main ways of protein concentrating are as follow:


1. Precipitate protein from large volume and dissolve it in a small volume
2. Apply protein solution on a small column of appropriate matrix and wash protein out by a
sharp step of appropriate eluent
3. Dialyse protein solution against concentrated (10-15%) solution of PEG 20000
4. Dry protein solution under steam of inert gas or air, under vacuum or freeze-dry
5. By Ultra filtration

Concentration by precipitation
Precipitants which are used for proteins:
Salts:
Ammonium Sulphate is mainly used for protein precipitation
Alcohols:
Ethanol, isopropanol, MPD
Polyols:
PEG of low MW (about 1000 Da)
Acetone
Acids:
Trichloracetic acid (TCA)
Using any kind of precipitation normally leads to at least 20% loss of the material (often
more).

Precipitation by ammonium sulphate


This is a widely used method for concentration and storage of proteins. See Protocols
section for ‘Protocol of precipitation’ and ‘Protocol for recovery of protein from the
ammonium sulphate precipitate’. Please notice that some proteins can be denatured by
high concentration of ammonium sulphate and cannot be recovered from the precipitate.
You should test this procedure on a small amount of TP first to be sure that it is
appropriate.
Precipitation by PEG
Precipitation by PEG based on the same routine: keeping solution cool and stirring, add
PEG1000 by small portions until it grows turbid. Stop stirring and leave sample overnight.
To recover protein spin down pellet, dissolve in a small volume of buffer and dialyse
intensively against large volume of buffer, 4-5 changes, each for 10-12 hours, because
PEG is difficult to dialyse out.

Precipitation by acetone
Precipitation by acetone could be useful if you need to prepare samples of protein under
denaturing conditions (for example, for gel analysis). Very few proteins could be
recovered from acetone precipitate natively.
To the protein sample add 10 volumes of cold (from the freezer) acetone. Spin down at 0-
4ºC for 20 min at 5000g or higher speed. Remove acetone from the tube and evaporate out
the rest of it under an air stream. Dissolve pellets in small volume of SDS, urea or Gu-HCl
solutions.
This method could not be applied for samples with high salt concentration because salt is
precipitated with the acetone as well.

63
Precipitation by acids
To precipitate proteins by TCA, add 50% solution into protein sample to make an acid
concentration of about 10%. Collect pellets by centrifugation. To dissolve precipitate, use
a basic solution of denaturing agents. This method is applied for preparation of denatured
samples and has no restrictions from the high salt concentration.
Mild acidic precipitation could be achieved by dialysing protein solution against Na
acetate pH 5.0. Proteins with pI close to 5 precipitate and could be collected by
centrifugation and dissolved in appropriate buffer of pH 7-8. As usual the method is
suitable for some proteins but not all of them. It is not rare for proteins to denature when
precipitated under acidic conditions.
All the above methods except the ammonium sulphate precipitation are rarely used
today.

Concentration by chromatography

This method is not one in frequent use, but sometimes you may want to use it.
It is most useful for concentration of very diluted protein, especially if the sample has a
high ammonium sulphate concentration.
Make a small column of appropriate hydrophobic resin (Phenyl-Toyopeal, as a rule). Take
1 ml of resin for 20mg of protein. Wash it with ammonium sulphate solution of
appropriate concentration (2.5M is fine for most proteins). Make sure that ammonium
sulphate concentration in the sample is high enough to allow protein to bind to column
(2.5M-3M of ammonium sulphate). Apply sample on a column. To collect concentrated
protein wash column with appropriate buffer (i.e. 50mM tris-HCl, pH 8.0). Collect 10
fractions equal to 1/3 – 1/2 volume of the column. Check protein concentration in the
fractions and combine fractions with the desirable level of protein concentration. Yield of
recovery could be between 50 and 80%.

A similar procedure can be applied for concentration of a dilute protein sample in low salt
buffer solutions. Choose appropriate ion-exchange resin. Elute protein with 1M NaCl in
appropriate buffer.

His-tagged protein could be concentrated this way too, but because affinity of His-tag to
Ni column vary from one protein to another, for many proteins it is not possible to obtain a
high concentration. For some proteins it is not possible to reach a concentration higher
than 3-4 mg/ml using this method.

Concentration by PEG 20000


Make 10-15% solution of PEG 20000 in appropriate buffer. Place on stirrer and make sure
the viscous solution is mixing properly. Put protein solution into a dialysis tube and leave
to dialyse. Check volume frequently, do not allow sample to become over concentrated.
When desirable volume is achieved, dialyse sample intensively against fresh buffer to
remove some low MW contaminations picked up from the PEG solution. Recovery is up
to 80%. Be careful about the integrity of the dialysis tube.

Concentration by evaporation
Volume of solution can be reduced (so protein concentration can be increased) by
evaporation of water. Water can be evaporated by a few techniques. To reduce volume of
the small samples (less than 0.2 ml) the simplest way is to use stream of air or better inert
gas (nitrogen, argon, etc). Place the protein solution into the eppendorf tube and mount it
on the stand. Connect tubing with thin opening (such as a gilson tip) to the air or gas tap
64
and mount it above the eppendorf tube. Make stream go through tubing, open tap slowly,
to make the solution in the tube move slightly. Check volume in the tube every 5-10 min.
It takes about 30-40 minutes to reduce volume by 0.1 ml or so. Remember that the salt
concentration increases too so you may need to perform dialysis against required buffer
afterwards.
Another way to reduce volume by evaporation is to use a vacuum to let water evaporate
quickly. Normally such evaporation is performed in a vacuum centrifuge called SpeedVac.
Depending on vacuum, it takes a few hours to evaporate about 1ml of water.
Another way to use evaporation is to dry the protein solution completely. For some
proteins (most stable ones) it is a good way of storage. It may be appropriate for some
proteins to be desalted by dialysis or gel filtration prior to drying. Alternatively, protein
can be dried in the presence of buffer. Drying (also known as lyophilisation) is performed
in the machine called a vacuum-freeze dryer. Place protein solution into the round, pear-
shaped or conical bottom flask. Volume of solution should be about 20% of the flask’s
volume. Solution should be distributed on the inner surface of the flask and frozen by
rotating flask in the bath with dry ice or liquid nitrogen. The frozen flask should be
immediately mounted on the working dryer.
Small volumes of protein (0.5-1ml) can also be dried on the machine. Put solution into an
eppendorf tube, close the lid, make a few holes in the lid, freeze sample in the liquid
nitrogen, place it in to the flask and mount flask to the dryer.

Concentration by ultra filtration


This is the most mild and widely used method. It is based on filtration of the protein
solution through a membrane with pores small enough to retain molecules of protein and
allow buffer to pass through. Because pores are very small, considerable force is required
to allow buffer to pass.
Mainly two types of devices are in use.
The first type is a pressure stirred unit. Compressed nitrogen is used to apply pressure for
filtration. Stirring prevents proteins from clogging the pores. So called Amicon units of
different sizes were common in the labs but not anymore.
The second type is a spin unit where the force of centrifugation is used. This method is
more convenient and simple to use and so practically expelled pressure units out of the
labs. There are a number of designs from different manufactures. We use Viva Spin
concentrators (Sartorius).
The most useful are Viva Spin 20 (for 20ml sample) and Viva Spin 6 (for 6ml sample).
Spin down at 4500xg-5000g.
Time required for concentration varies from protein to protein.
Viva Spin units can be reused several times, but remember to wash them with plenty of
water immediately after use.
Use a 200µl tip to collect sample from the Viva Spin unit.
Viva Spin 20 with a diafiltration cap could also be used for buffer exchange.
We also use 0.5ml VivaSpin units for concentrating of small volumes. Apply 12000g for
a few minutes. Use gel loading tip to take concentrated sample out of unit.
Please note that during centrifugation protein concentration becomes very
high at the bottom of the concentrator which could cause protein
precipitation. For some proteins it is useful to do concentration in short (5-
10min) shots with the mixing of the sample after each shot .

65
3. How to store proteins

The safest way to use proteins is to use them fresh, in a few hours or days after
purification. Nevertheless the majority of proteins can be successfully stored using three
main methods:
 Frozen at -20oC or better -70oC
 Precipitated with ammonium sulphate at 4oC or even room temperature
 Vacuum dried

Freezing

Protein solutions could be frozen and kept at freezing temperatures for a very long time.
The best way to freeze protein is to place it in liquid nitrogen. But for many proteins it is
OK just to put them in the freezer.
For concentrated protein solutions (more than 10mg/ml) it is not necessary to add anti-
freezing agent such as glycerol, but for dilute solutions it is better to add glycerol to a 10-
40% concentration.

Precipitation

Follow the ‘Protocol for precipitation of proteins using ammonium sulphate’.


Samples can be stored at 4oC for years. Make sure that the container is properly sealed.
To recover protein for use, refer to ‘Recovery of protein from the ammonium sulphate
precipitate’ protocol.
This is a good and fairly universal method for protein storage, but remember, some
proteins do not survive this procedure.

Vacuum drying

Proteins can be dried as described above (Concentration by evaporation).


Seal container with the dried protein properly and keep it at room temperature, at 4oC or in
the freezer.
If you keep sample below room temperature and you do not want to use the whole
sample at once remember to warm sample to room temperature before you open the
container to prevent moisture condensation on the cold powder.
The same rule is applied to any reagent kept below room temperature.

66
4. How to estimate purity of a protein preparation

It is difficult to estimate purity of a protein preparation accurately. Generally speaking to


do this we have to measure accurately total protein concentration and concentration of a
target protein in the preparation. Is it possible? Quantitive N-terminus analysis? Some of
contaminations can have the same N-terminal amino acid...
Any way it is just SDS-PAGE analysis we typically use for this task and we only can
roughly estimate the purity of a protein preparation.
We run gel, stain it with appropriate stain and hopefully have got clear gel with sharp
protein bands. If we have scanning instrument we can have a scan and calculate proportion
of light absorption of target protein band from the total of all peaks.
If we have not got a scanner we can use more rough method below.

On gel applied is protein called EctC:


100% 20µg
10% 2 µg
1% 0.2 µg
0.1% 0.02 µg

Comparing band of contaminating proteins from


100% line with EctC bands on 10%, 1% and 0.1% lines we
can estimate purity of the prep to be around 85% :
four main contaminating bands are 1-3%
(say about 10% in total)
20 or so small bands are in range 0.1-0.5%
(say about 5% in total)

67
68
VII. Appendix 2
1. Prepare your solutions right!

69
2. Gel Filtration
Separation by molecule’s size
Elution

Narrow zone
of applied
sample

concentration

V0 Ve Ve Vl
volume

Separation by molecule’s size


In gel filtration molecules in solutionElution
are separated by their size while they are pass trough
column packed with gel matrix filled with liquid. This matrix consists of porous beads.
Narroware
The pores in the beads zonecomparable in size to the molecules to be separated. Very small
of applied
molecules can penetrate the beads completely, while the bigger molecules can only enter larger
sample
pores, and there could be molecules which are too big to enter pores at all. For simplicity of
understanding we can present the bead with large conical pore which represents all possible pore
sizes, as shown on the carton. By penetrating pores deeper smaller molecules stays in matrix
longer, or in more accurate terms they need larger volume of liquid to be washed out of column.
Zonal separation. The sample is applied on a column as a narrow zone, 1-5% of column
volume. During elution zone of each component become wider due to diffusion. Separation
power depends on a beads size: the smaller are the beads, the lower is diffusion, peaks are
sharper and separation is better.
Depending on pores size there are different gel filtration media for separation molecules of
different size range.
Practical use of gel filtration is not just for protein purification, but also for analysis of the
oligomeric state of proteins and protein complexes. Column can be calibrated using proteins
of a known size, which for globular proteins is proportional to molecular weight.
In practice the calibration plot is produced as elution volume versus molecular weight. The
linear relation in gel filtration was found between elution volume and logMW.

The calibration plot however is usually presented as a Kav versus LogMW. This way the
calibration plot became independent of the column parameters.

70
Kav is proportion of inner beads volume available for the particular protein.

Vo – void volume
Ve – elution volume
Vt – total column volume
Obtaining a calibration plot

71
Here is presented the calibration plot
obtained for the gel filtration media
Superdex 200.

Mixtures of a standard proteins (Low


and High MW kits from GE Healthcare)
were run on a 1.6x60 cm HiLoad
Superdex200 column (GE Healthcare).

Kav was determined for the each peak


and plotted versus logMW.

Main reasons for “abnormal” mobility of some proteins during gel


filtration
1. Compactness. Calibration plot we use for calculations is done for MW, but gel-
filtration separates molecules by their sizes and not by their masses.
Proteins of the same MW can have more compact fold and can have less compact fold, so
two protein of the same MW can differ from each other in size.
The standard proteins have average fold, typical for most of proteins.
Among other proteins, as for everything, we have Gaussian distribution, so some of the
proteins have more compact fold then the standards, some can have less compact fold.
2. Shape. Most of the proteins are globular, and so are standard proteins.
But some of the proteins may be very asymmetrical. Very elongated molecules behave as
larger ones, and elutes from the gel filtration column early in comparing with globular
molecules of the same MW.
3.” Water coat”. Also, having different surfaces, proteins have different amount of tightly
bound water molecules on their surfaces, which also contributes to mobility of their
molecules in solution.
4. Interaction with matrix. Proteins can have some affinity to the gel filtration matrix
and so, being bound-unbound to the matrix during elution, such proteins elute from the
column later, demonstrating lower apparent MW then the real one.
5. Equilibrium. Some of the proteins do not form stable oligomers, but exists in state of
fast equilibrium monomer-dimer or dimer-tetramer, etc. In these cases the apparent MW
on gel filtration occurs to fall between the two values.

72
3. Time-saving tips
in protein purification
 Make proper stock solution which will last for a long time so you can prepare
any buffer solution for your purification in seconds
 When preparing cell free extract by sonication divide cell suspension between
2-4 portions and put pieces of ice into them so you can save time on the
cooling
 To remove cell debris apply only 10-15 min centrifugation, the longer spins
is not practical because there is no need to remove small particles as they pass
the column safely causing no harm
 After you apply sample on the column do not wash out unbound material
with the starting buffer. The only exception is if the target protein (TP) is
going to be eluted from the column very close to the start of the salt gradient.
With the beginning of the salt gradient the unbound material is removed from
the column much more effectively than with the starting buffer
 If expression level of TP is higher than 10%, in most cases the highest protein
peak on the chromatogram is TP. So you can find it by checking protein
concentrations in fractions by the fast Bradford method and save time on gel
analysis
 If you need to analyse fractions by gel and you have not got pre-cast gels,
then start to prepare gel immediately after you have started the
chromatography
 Do not wait until all gradient is applied on a column. It is useful to start to
analyse protein concentration and activity (if applied) in the fractions after
about one third of the gradient have been applied on a column. This is
normally the position of TP elution if gradient was properly optimised
 If you use a gel to find TP after first chromatography, to reveal result
quickly stain gel for 5-10 min with fresh stain and distain it briefly for a few
minutes so as to reveal just the major bands. As a rule, TP can be identified
successfully this way. Combine appropriate fractions and move on for the
next purification step leaving gel to be properly stained-distained later.

73
4. Golden Rules
in protein purification
 DO NOT DISCARD ANYTHING (pellets, supernatant fractions or
fractions obtained during any chromatography) until purification is
complete and analysed by SDS-PAGE.
Always collect flow through column fraction.

 Keep small samples of protein from each stage of the purification


procedure for the final SDS-PAGE analysis

 Keep your attention to the purification, do not get distracted by other


activities

 Keep chromatography system clean, always wash it with water, 20%


ethanol or 1-2mM EDTA solution after use

 Have a basic set of columns pre-packed and keep them in good order.
Always wash ion-exchange columns with 2M NaCl and hydrophobic
columns with water after use

 Keep your pipettors in good order, never allow liquid inside the pipettor.
It is best to have your own set, clean them trough once a year and check
their calibration

74
VIII. Show cases
1. BPSL 1549 (BLF1)
Two step purification and a lesson to learn
BPSL 1549 (Burkholderia Lethal Factor 1) was the most interesting project done in our
crystallographic group so far. Apart of its biological role (Science 334, 821-824, 2011) it also
shows some unusual features as a protein.
ProtParam results revealed just one unusual feature:
MW 23342Da
pI 5.14
Abs 0.1% (1mg/ml)= 2.4 It is very high and rather unusual.
BPSL 1549, back then being referred as a putative protein of unknown function, was highly
expressed in TUNER cells, where chloramphenicol-acyl-transpherase (CAT) (23kDa) normally
also being expressed to a significant level.
Because of that analysing level and solubility of expression (see gel picture below) we could
not be sure was there the target protein expressed or was it CAT.
1 2 3

1. Mark12 MW standard
2. Cell debris
3. Cell free extract CFE)

31kDa →
20kDa →

The standard approach for an acidic protein was applied for the purification.
Cell free extract was prepared in Buffer A and applied on a 25ml DEAE-Sepharose FF column.
300ml gradient from 0 to 0.5M NaCl was applied for elution. 7.5ml fractions were collected.
Because of the very high level of expression I have relayed on a protein concentration estimated
by method of Bradford to find the elution position of the target protein (see the chart below)
0.9 2.5
A 595 [NaCl], M
0.8
0.7 2
0.6
1.5
0.5
0.4
1
0.3
0.2 0.5
0.1
0 0
0 5 10 15 20 25 30 35 40

Fractions

75
The main protein peak was found eluted with about 0.24M NaCl . It was position where CAT
elutes from the column, but it also did not contradict with the target protein pI 5.14.
Two fractions with the highest protein concentration were combined, concentrated using Viva
Spin concentrator and applied on a gel filtration column, Hi Load Superdex200.
Peak was eluted at 75ml, suggesting MW about 70kDa, the position where CAT elutes from the
Superdex200 column.
To confirm that it was CAT, the sample was supplied with 1.5M ammonium sulphate and
applied on 8ml Phenyl Toyopearl 650S column. Elution was performed by the 80ml reverse
gradient of ammonium sulphate concentration from 1.5M to 0 in Buffer A. 4ml fractions were
collected and analysed by method of Bradford. Protein peak was found at a very end of the
gradient, where CAT elutes from the Phenyl Toyopearl column.
It looked like that target protein was not expressed, but if so, the one thing was odd – the level
of expression of the 23kDa protein was much higher than the normal level of CAT expression
under the same standard growth conditions.
At that point SDS PAGE analysis was employed (NuPage 4-12% BT Novex gel, see picture
below) and revealed massive protein peak in the beginning of the gradient, at about 80mM NaCl
(fr. 5-11) .

Mark12 deb CFE 3 5 7 9 11 13 15 17 19 21 23 25 35 fractions

BPSL1549 CAT

Fractions 7 and 8 were combined, concentrated to 2ml and applied on a Superdex200 column.
Peak was eluted at 90ml, which suggested a monomeric state of the BPSL1549 in solution.
So, BPSL1549 does not react with the Bradford reagent properly. It does react with Coomassi
only when denatured by SDS and exhibits a good bands in the gel, but it does show very low
reaction with Coomassi under normal assay conditions (see Bradford calibration plot for
BPSL1549 below).

Bradford calibration plot for BPSL1549

0.8
A 595
0.6
BPSL1549
0.4 BSA
Linear (BSA)
0.2

0
0 10 20 30 40 50 60 70 80
protein, microgram

76
It was a good lesson which showed me that 20 years experience is not 100% relevant and one
day the convinient short cut may fail dramatically. Since then when I develop the purification
protocol for a new protein I run the SDS PAGE to analyse an elution profile on a first
chromatographic step.
Apart of the trouble with the Bradford’s method, this purification is a good example of two step
purification protocol. High level of expression and early elution from DEAE-Sepharose makes
it possible to obtain 95%+ purity by combination of AEC and SEC. See below the refined
purification procedure with the use of AKTA system.

Typical purification of BPSL1549

About 1g of the cell paste was defrosted, suspended in about 27ml of buffer A and disrupted by
sonication. Debris was removed by centrifugation (10 min at 70000g). CFE was obtained in
27ml, protein concentration by Bradford =2.7mg/ml, total 73mg (total protein here mainly
corresponds to [Link] proteins).
CFE was applied on a 5ml Hi-Trap DEAE FF cartridge. 40ml (8CV) of the gradient 0 to 0.3M
NaCl was applied for elution. Elution was performed at flow rate 4ml/min, 3ml fractions were
collected (see chromatogram below).

8mS/cm
~0.08MNaCl

In fractions from 10 to 14 there is a big peak of absorbance at 280nm . This peak


corresponds to BPSL1549 due to unusualy high extinction coefficient, which makes it
easy to identify fractions to be combined, namely, 11-13.

Volume of combined fractions was 9ml, concentration was mesuared by absorbance at


280 nm and was equal 3.3mg/ml, total protein about 30mg.

Sample was concentrated to 2ml using Viva Spin concentrator and applied on a 16x60 Hi-
Load Superdex200 column. Gel filtration was performed at flow rate 1.5ml/min in Buffer
A suplimented with 0.5M NaCl (“standard GF buffer”).

2ml fractions were collected after 74 ml of elution (see chromatogram below)

77
Peak of A280 was observed in fractions 7 to 11.
Fractions 8-10 were combined, volume 6ml, concentartion 2.6mg/ml (by A280),
total yield 15mg.

Progress of BPSL1549 purification

SDS PAGE analysis on NuPage 4-12%BT Novex gel


Mark 12 MW
1 2 3 4 standards

1. Mark 12

2. CFE

3. DEAE fr 11-13

4. Gel filtration fr 8-10

Purity estimated by SDS PAGE was not less then 95%.


Yeild 15mg from 1g of cells

78
2. It is easy with coloured proteins!

Proteins containing chromophores are easy to purify because no time is required


for identification of fractions with the target protein. Typically coloured fractions
are combined after each chromatography.
Represented below are purification of two haemoglobins, Cgb from
Campylobacter jejuni and Hmp from Escherichia coli (in collaboration with Prof.
R. Pool group)

Single-domain haemoglobin Cgb from Campylobacter jejuni


MW 16081Da
pI 6.14
A280 1mg/ml 0.9

Cgb was expressed in [Link] BL 21 strain and though the overall level of expression was
relatively high it was mainly insoluble. Only 10-15% of the expressed Cgb was presented in the
cell free extract, so that Cgb represented not more then 1-2% of total protein in the CFE.
Generally speaking it is unlikely to succeed with 3step purification protocol with so low
expression level of the target protein, but lucky combination of the properties of Cgb made it
possible.
Firstly, the protein has pI 6.14 and so it have relatively low affinity to anion exchanger. pH for
the first (DEAE-Sepharose) chromatography had to be increased to 9 and salt concentration had
to low down to 3mS/cm in conductivity terms in order to bind Cgb to the column. So it was
eluted from the column at very beginning of NaCl gradient, where not too many [Link] proteins
appeared.
Secondly, Cgb was found to be relatively hydrophilic protein so powerful HIC was applicable.
Thirdly, Cgb is a monomer of 16kDa and so gel filtration worked well to separate main
contaminations remained after HIC.
Below is presented optimized and refined procedure for Cgb purification.
Cell free extract (CFE) was prepared in bufferA(50mM tris buffer pH 9.0) using cells from 2l
culture (about 7g). Cells were disrupted by sonication (3x20sec at 16micron amplitude) and cell
debris was removed by 10 min centrifugation at 72000g.
CFE: V=34ml, C=16mg/ml, total protein 540mg. Conductivity was checked in CFE and it was
diluted with water to 3mS/cm (total volume of the sample became 50ml).
CFE was applied on a 25ml DEAE-Sepharose column at flow rate 5ml/min on AKTA purifier
system. 5ml fractions were collected. Elution was performed with 250ml of NaCl concentration
gradient from 0 to 0.3M in 50mM tris-HCl pH 9.0 (see chromatogram below).

Red fractions 21-24 were combined: V=20ml, C=0.9mg/ml, 18mg

79
Sample was supplemented with 9ml of 4M ammonium sulphate (to 1.25M) and applied on a
5ml HiTrap-Phenyl-HP column at flow rate 4ml/min. Elution was done by reverse concentration
of ammonium sulphate from 1.2M to 0 in bufferA. 2.5ml fractions were collected.

Red fractions 13-15 were combined: V=7.5ml, C=0.6mg/ml, 4.5mg. Red fraction 16 had not
been taken on grounds of having high A280 and so being more contaminated than other fractions.
Volume was reduced to 2ml using VivaSpin device with MWCO 5000 and sample was applied
on a 1.6x60cmHiLoad Superdex200 column. Gel filtration was performed at flow rate
1.5ml/min and 2ml fractions were collected:

Red fractions 5+6 were combined: V=4ml, C=0.5mg/ml, 2mg.


Progress of purification was analysed by SDS-PAGE (NuPage 4-12%BT Novex gel with MES
running buffer):
Mark 12 MW
1 2 3 4 5 6 standards
1. Cell debris
2. CFE
3. After AEC
4. After HIC
5. Final prep
6. Mark12 MW
std
Cgb was purified to purity of about 90%
14.5kDa
Yield was 1mg from 1 l culture
0.4% of total CFE protein.

80
Flavohemoprotein HMP from Escherichia coli
MW 43837Da
pI 5.5
A280 1mg/ml 1.16

HMP contains two chromophores, Flavin and Hem, so colour of the protein has a bit of orange
shade, which does not make a significant contribution to the shape of a visible spectrum of the
protein any way.
Level of expression of HMP typically is low, hardly exceed 3%, so we would not expect to
purify it to 90%+ purity in 3 step procedure, but this case is an exception and it is possible with
application of standard AEC-HIC-SEC protocol. However it was suspected that protein is losing
some of flavin during HIC step and it was replaced with second AEC using different matrix
(DEAE Toyopearl or Resource Q) and pH. Purity of the protein is lower in this case (about
80%) and preps have one significant contamination (a few %) of 20kDa protein.

Typical purification using AKTA purifier was as follows:


About 7g cell paste was defrosted and suspended in 20ml of buffer A (tris-HCl pH 9.0).
Sonication: 3 cyclesx20sec.
Centrifugation: 15 minutes at 72000g.
CFE: V=23ml, C=20mg/ml, 460mg
AEC was performed on AKTA purifier system at flow rate 5ml/min. Sample was applied on a
1.6x10cm Hi Prep DEAE Sepharose column (GE Healthcare). Elution was done by 160ml of
gradient of NaCl concentration from 0 to 0.5M in buffer A. 5ml fractions were collected. 1M
NaCl wash was applied when red fractions were eluted:

16mS/cm

Spectra were measured for red fractions and ratio A412/A276 was calculated:
Fr A412/A276 (R)
25 0.18
26 0.32
27 0.36
28 0.32
29 0.25
Fractions with highest ratio, 26-28, were combined: V=15ml, C=4.35mg/ml, 65mg, R=0.33

81
Sample was diluted with water to conductivity 6mS/cm and applied on a 6ml Resource Q
column.
Flow rate 5ml/min, fractions 2.5ml. Gradient: 90 ml 50-250mM NaCl in 50mM MES pH 6.5.

11mS/cm

Spectra were taken from red fractions and peaks ratio was calculated
Fr A405/A280
14 0.66
15 0.77
16 0.86
17 0.82
19 0.64
Fractions 15-17 were combined: V=7.5ml, C=1.25mg/ml, 9.3mg R=0.82
Volume was reduced (using VivaSpin) to 1.25ml, C=7mg/ml, 8.5mg and was applied on a
1.6x60cmSuperdex200 column equilibrated in 0.5M NaCl, 50mM tris-HCl pH 8.0 buffer.
Flow rate1.5ml/min, fractions 2ml.

Fractions 9-11were combined: V=6ml, C=0.75mg/ml, 4.5mg R=1.05

82
Purification progress was analysed by SDS-PAGE (NuPage 4-12% BT Novex gel )

1 2 3 4 5 6 Mark 12 MW
1. Cell debris standards
2. CFE
[Link] DEAE
4. After Resource Q
5 Final prep
6. Mark 12

On a different occasion I had compare two protocols, AEC-AEC-SEC and AEC-HIC-SEC.


Second AEC was replaced with HIC. HMP is relatively hydrophobic protein, so early I used
Ethyl-Toyoperl and later a standard 5ml Phenyl-HP cartridge, from which HMP eluted in very
end of reverse gradient of ammonium sulphate concentration, with 0.1M. As you can see on gel
below, purity after this step is poorer then after second AEC(compare line 4 and 6) , but most of
contaminations were successfully separated by gel filtration.
Yield was equal in both cases, 0.8% from total CFE protein.
1 2 3 4 5 6 7
1. Mark12
2. CFE
3. after DEAE-Sepharose pH 9.0
4. after Resource Q pH 6.3
5. after gel filtration (prep 1)
6. after Phenyl-HP (part of the sample from
DEAE-Sepharose was applied on a hydrophobic
column)
7. after gel filtration (prep2)

83
R=0.95 R=1.2
R=1.2

Prep 1( AEC-AEC-SEC) Prep 2 (AEC-HIC-SEC)

84
3. Almost typical three step purification
Glutamate dehydrogenase from Clostridium symbiosum
ProtParam results for the target protein:
MW 49296 Da
pI 5.1
Abs 0.1% (1mg/ml) 1.195
GluDH was over expressed in BL21 (DE) cells. Analysis of over expression revealed a very high
level of soluble expression. Typically for such a high level of expression a significant band of
GluDH was also found in the cell debris.
1 2 3

1. Mark 12 MW standards
2. Cell debris (pellet)
kDa 3. Cell free extract

55
36

Cell free extract was prepared in Buffer A (50mM tris-HCl pH 8.0) from about 2g of defrosted
cells as described in the Protocol number 2.
CFE: V=23ml, protein concentration (by Bradford, Protocol number 9) = 5.5mg/ml,
total protein 125mg.
CFE was applied on a 5ml Hi Trap DEAE FF cartridge washed with 5ml of BufferA and proteins
were eluted by 50ml (10CV) gradient 0-0.5M NaCl in Buffer A at flow rate 4ml/min. 2ml
fractions were collected. Protein concentration was measured in fractions by method of Bradford
and fractions with protein were analysed by SDS-PAGE (Novex Nu-Page BT 4-12% gel). (see
chart and gel picture below).

Unbound
material

CP CFE 4 10 12 14 16 17 18 19 20 21 22 24 fractions

85
GluDH were eluted as a broad peak due to a very high expression, also some of the GluDH was
found in the unbound material, which also is not unusual for heavily expressed proteins. Column
volume has to be doubled in this case (two 5ml cartridges screwed together) to improve protein
binding and yield.
Fractions 17-22 were combined, volume 12ml, C=4.5mg/ml, total 54mg.
The sample was supplemented with 7.2ml of 4M ammonium sulphate to bring ammonium
sulphate in the sample to 1.5M and applied on a 5ml Phenyl-HP cartridge. Elution was done by
50ml (10CV) of the reverse gradient of concentration of (NH4)2SO4 from 1.5M to 0 in Buffer
A at flow rate 5ml/min. 2ml fractions were collected.
On this stage the peak is very obvious, A280 corresponds to protein, fractions to combine are
easy to identify as 22-24. SDS-PAGE is not essential here and was done later just for
demonstration.

Phe-HP 20 21 22 23 24 25 26 28 31 Fractions

GluDH was eluted from column with 0.65M ammonium sulphate, which was found by
measuring the refraction in fraction 23. This means that optimal gradient for this protein is from
1-0.9M to 0 of ammonium sulphate while length of gradient could be reduced to 40ml (8 CV).
Fractions 22-24 were combined, volume 6ml, protein concentration 2.7mg/ml, total protein
16mg.
The volume of the sample was reduced to 2ml using Viva Spin concentrator 30000 MWCO and
sample was applied on a gel filtration column, 1.6x60cm HiLoad Superdex200.
Gel filtration was performed in buffer 0.5M NaCl, 50mM tris pH 8.0 at flow rate 1.5ml/min.
2ml fractions were collected after void volume. GluDH was eluted at 60.3ml with apparent MW
290kDa, which indicates that GluDH is a hexamer. Once again, there are two obvious fractions
to harvest, 11 and 12.
Fr 11+12: V= 4ml, C=1.7mg/ml, 7mg totally.

GFl 10 11 12 13 14 fractions
86
SDS PAGE (Novex BT 4-12% gel) was performed to analyse progress of the purification.
In this case, despite a very high expression, two purification steps were not enough to
reach acceptable purity. This is because on both AEC and HIC GluDH elutes with the
majority of other proteins. In this case gel filtration works very well, due to hexameric
state of the GluDH molecule.

Total protein Purity


CFE 130mg ~15%
AEC 54mg ~40%
HIC 16mg ~60%
GF 7mg ~90-95%

CP CFE AEC HIC GF

The protocol works very well with much lower expression level:

CFE 50mg ~3%


AEC 11mg ~6%
HIC 6.7mg ~25%
GF 0.6mg ~80-85%

Mark 12 MW
standards

CFE AEC HIC GF

87
4. Monitoring purification by enzyme activity
Glutamate dehydrogenase from Clostridium symbiosium

Here I would like to show how purification can be performed based on enzymatic activity of a
target protein. GDH is a good example because activity assay is very simple and quick.

Activity assay:
1mM NAD, 20mM Na glutamate, 50mM K Phosphate pH 7.0. NAD reduction to NADH can
be monitored by absorbance at 340nm.
Mixture composition:
0.96ml KPhosphate buffer
20µl 1M Na Glu
10µl 0.1M NAD
1-20µl GDH solution
Absorbance at 340nm is monitored for 1-2 minutes. Change in absorbance is used to calculate
NADH production using extinction coefficient 6220M-1cm-1.

Purification procedure
CFE was prepared in 0.1M K Phosphate pH 7.0 on this occasion. C=9.5mg/ml, V=9ml, total
protein 85mg. Specific activity in CFE was found to be 8.0u/mg. Total activity 680u.
CFE was diluted fourfold to reduce ionic strength and was applied on a 5ml DEAE FF cartridge.
Chromatography was performed on AKTA purifier system at flow rate 4ml/min. Elution was
performed with 50ml gradient of NaCl concentration from 0 to 0.5M in 20mM K Phosphate
pH 7.0 buffer. 2.5ml fractions were collected.

u/ml
u/mg

50
10

30
6

10 2

88
Activity was measured in every third fraction to the point when activity was found and then
activity and protein concentration were measured in each fraction as shown below:

Fraction Activity Protein conc. Specific activity


(u/ml) (mg/ml) (u/mg)
6 0.8
10 0.3
13 0.3
15 12.1 1.65 7.3
16 22.0 3.1 7.1
17 34.1 4.7 7.2
18 39.3 5.2 7.6
19 25.8 4.1 6.3
20 18.4 3.1 5.9
21 10.1 2.4 4.2
22 4.5 1.5 3

Fractions 15-19 with highest specific activity were combined: V=12.5ml, C=3.45mg/ml, 43mg,
7.1u/mg, 305u
Sample was supplemented with 1M ammonium sulphate and applied on a 5ml Phenyl-HP
cartridge. Elution was performed by 50ml of reverse gradient of ammonium sulphate
concentration from 1.2 to 0M in 20mM K Phosphate buffer. 2 ml fractions were collected.

u/ml u/mg

Activity and protein concentration were measured across the UV peak:

Fraction Activity Protein conc. Specific activity


20 4.0 0.4 8.0
21 18.0 1.9 9.5
22 34.3 3.7 9.3
23 35.7 3.8 9.4
24 29.9 3.0 10.1
25 20.9 1.7 11.8
26 7.7 1 7.7

Fractions 21-25 were combined: V=10ml, C=2.55mg/ml, 25.5mg, 10.5u/mg, 268u

89
Volume of the sample was reduced to 1ml using VivaSpin and applied on a 1.6x60cm
HiLoad Superdex200 gel filtration column.
Gel filtration was run at flow rate 1.5ml/min in 0.1M K Phosphate pH 7.0 buffer. 2ml
fractions were collected.

Peak fractions 10+11 were combined: V=4ml, C=2.4mg/ml, 9.8mg. Specific activity 21.7u/mg.

Summary:

Protein Total Activity Specific Total Purification Yield


conc. protein u/ml Activity Activity fold %
mg/ml mg u/mg u
CFE 9.5 85 34.8 8.0 680
DEAE 3.45 43 30.8 8.9 390 1.1 57
Phenyl- 2.55 25.5 27.9 10.9 278 1.2 41
HP
GF 2.4 9.8 72 21.7 212 2.7 31

90
5. Power and failure of dye pseudo affinity chromatography
Phenylalanine Dehydrogenase from Nocardia sp.

Purification of PheDH from Nocardia sp. is interesting example of the protein purification from
the native source. PheDH was naturally over expressed in the Nocardia cells by growing culture
in the presence of phenylalanine. Half a kilo of the cell paste was sent to us from Proton Down
alongside with the simple one step purification protocol which employed pseudo affinity
chromatography on a Procion Red HE-3B Sepharose4B. A pot of the matrix was also included.
This type of chromatography often is used for purification of dehydrogenases because of
similarity in molecular structures of dye and NAD, one of the dehydrogenase substrates.
Purification protocol suggested that CFE to be applied on a Red column in 50mM tris buffer
pH 8.5, unbound material to be removed by washing the column with the starting buffer and
then PheDH to be eluted bio specifically with 1mM NADH in the same buffer.

According to the protocol CFE was prepared from 50g of cell paste in 50mM tris buffer pH 8.5
by the standard procedure (Protocol 2).
CFE: V=180ml, C=15mg/ml, total protein 2700mg.
Monitoring of the target protein in this case was done by activity. There is a fast and easy assay
based on monitoring of NADH produced in reaction of oxidative deamination of phenylalanine
by measuring absorbance at 340nm.
The specific activity in the CFE was found to be 0.1U/mg, suggesting level of expression of
PheDH was about 2% of total protein.
Red Sepharose chromatography: Sample of 80ml of CFE (1200mg total protein, 120U
activity) was applied on a 30ml Red Sepharose column at flow rate 3ml/min. Column was
washed with the starting buffer (50mM tris-HCl pH 8.5).
Unbound fraction: V= 150ml, 4.5mg/ml, total 675mg, 66U activity. It was clear that something
is not right: just 50% of total protein was found instead of expected 90% or so and also specific
activity in this fraction was the same as in the CFE. It looked like half of the protein was bound
to the column non-specifically. Active fractions
1 2 3
Elution was performed with 1mM NADH. 8ml fractions were collected and
checked for activity. Activity was found in three fractions and was just 8U in
total. Specific activity was 1.8U/mg. SDS-PAGE (10% Laemmly gel) analysis
reveal purity not better then 60-65%:
So, 80% of bound PheDH was stacked on the column irreversibly, yield of the
chromatography was 6.6% and a lot of protein was bound to the column non-
specifically.
Further purification was attempted employing gel filtration on a 1.6x60cm
Hi-Load Superdex200 which resulted in 2mg prep with specific activity
2.9U/mg. SDS-PAGE analysis suggested about 75% purity. (See below,
Preparation 1).
So, Dye chromatography failed and most likely particularly batch of the home made matrix
was to blame. Commercial Red Sepharose CL-6B was ordered from Pharmacia (now GE
Healthcare) for comparison.
What may be wrong with the matrix? The fact that half of material was bound to the column
non-specifically most likely is due to that “aggressive sites” in the matrix which was a common
knowledge among biochemists on early days of protein purification, when cellulose based
matrixes were in use. Sepharose normally is much better in respect with non-specific binding,
but it was subjected to some drastic conditions (like NaOH) during the dye binding which could
lead to such an “aggressive sites”. The method to fight a problem is to saturate these sites with
the protein. In hope that saturation was achieved during the first chromatography I give the
column the second chance. But on a way I decided to try IEC as well using the material that was
not bound to the column on the first run.

91
Anion exchange chromatography. Flow through fraction from Red column (675mg of total
protein, 66U of activity) was applied on a 25ml DEAE-Sepharose column; elution was
performed by 300ml NaCl gradient from 0 to 0.4M NaCl in 50mM tris-HCl buffer pH 8.5. 8ml
fractions were collected and checked for activity. Active fractions containing 140mg of total
protein, 49U activity, 0.35U/mg. Purification fold is 3.5 which is reasonable, but not very high.
Red Sepharose. Sample obtained after DEAE chromatography was concentrated to 4.5ml and
applied on a 30ml Red-Sepharose column . Column was washed with 50mM tris-HCl buffer pH
8.5 and PheDH eluted with 1mM NADH. This time activity was bound to the column and
successfully eluted, given 7.9mg of total protein and 24U activity. SDS-PAGE analysis revealed
purity on this stage being about 80-85%:
1 2 3

1. Sample applied on a Red-Sepharose


2-3. Active fractions

Activity assay: 0.2M Glycine buffer pH 10.8


3mM NAD+
5mM Phenylalanine

Still PheDH yield on this stage was 50% which was an improvement from 6.6%, but what we
expect from affinity chromatography is 70-90%, so seems some of protein still was stacked to
the matrix.
For further purification sample was concentrated and subjected to gel filtration. Combined
active fractions contained 4.8mg of protein with specific activity 3.4U/mg. Purity estimated by
SDS-PAGE was about 90%. (See gel below, Preparation 2)
The remaining 100ml of the CFE (1500mg of total protein, 150U activity) was subjected to 3
step purification protocol.
AEC: chromatography was done on a 25ml DEAE-Sepharose column, gradient 300ml from 0
to 0.4M NaCl, 8ml fractions were collected and checked for activity. Active fractions were
combined, in total 122U of activity, 380mg of total protein, specific activity 0.32U/mg.
AS cut:AmSO4 was added to the sample to 1.4M. Significant pellet was removed by
centrifugation. No activity was found in the pellet. In the supernatant fraction there was 270mg
of total protein with specific activity 0.4U/mg, 108U.
HIC: Sample was applied on a 25ml Butyl-Toyopearl column and eluted by 300ml of gradient
of ammonium sulphate from 1.4 to 0 in buffer A. Activity was found in fractions eluted with
about 0.3M ammonium sulphate. Two fractions with the highest specific activity were
combined, 15mg total protein, purity by SDS-PAGE about 40%:

1 2 3 4 5 6 7
1. Mark12 MW standard
2. CFE
3. DEAE-Sepharose
4-7. Butyl-Toyopearl fractions
with PheDH activity

92
SEC:Sample was concentrated and applied on a gel filtration column equilibrated in 50mM tris-
HCl pH 8.5. 2ml fractions were collected and analysed for activity and protein concentration.
Three fractions with the highest activity were combined, yielded in 5mg of the protein with
specific activity 2.5U/mg, about 60% purity estimated by SDS-PAGE:

1 2 3 4 5 6 7
1. Mark 12
2. Sample applied on a gel filtration
column
3-7. Fractions across activity peak

With a target protein still not pure and with a little option left I have attempted to employ Red
column on this stage. Sample obtained after gel filtration was applied on a 15ml Red –Sepharose
(commercial, from Pharmacia) column and this time activity was bound to the column and after
elution with 1mM NADH 3.8mg of PheDH was obtained with specific activity 3.6U/mg and
apparent purity on SDS-PAGE better than 90%. (Preparation 3). Still very low yield, but at
least purity was OK.
Comparison of the three preparations:
Preparations 1 2 3 Prep Specific Purity Yield
Activity by SDS-PAGE

1 RShm+GF 2.9U/mg 75% 4.8%

2 UnboundRShm+IEC+RShm 3.3U/mg 85% 24%

3 IEC+HIC+GF+RSc 3.6U/mg 90%+ 9.5%

RShm=Red Sepharose home made


RSc=Red Sepharose commercial

Apparently method 2 was the best, but the disadvantage of this one was that we still need to use
big Red-Sepharose column and spend about 60ml of expensive NADH for elution.
Later I have found way to improve ammonium sulphate cut and even without Red
chromatography about 80-85% purity of the PheDH preparations could be achieved with “3step
protocol”. Purity was good enough for crystallisation. However, later we had attempted to
obtain amino acid sequence of the protein by Edman degradation. For that purpose high purity
of the protein was essential and Red chromatography was back, but on a smaller column, with
less NADH to be spent.
The typical purification procedure of PheDH from Nocardia is presented below.

Purification of PheDH Nocardia 1.8.2002


CFE was prepared from 30g of cell paste in Buffer A.
AEC: Sample (total 2400mg of protein, 220U activity) was applied on a 60ml column with
DEAE-Sepharose FF at flow rate 10ml/min. Elution was performed with 500ml of NaCl
93
concentration gradient 0-0.4M. 8ml fractions were collected and analysed for activity and
protein concentration (by Bradford):

Fractions 16-28 were combined, V=92ml, total protein 662mg, 170U activity.
AS cut: 73ml of 4M ammonium sulphate were added to bring AS concentration to 1.8M. Pellet
was spun down and dissolved in Buffer A. 4M AS solution was added to the sample to bring AS
concentration to 0.9M. Pellet was spun down.
HIC: Supernatant fraction containing 227mg of total protein and 152U of activity was applied
on a 25ml column with Butyl-Toypearl 650S, equilibrated in BufferA+0.9M AS at flow rate
3ml/min. Elution was performed with 250ml of reverse gradient of AS in Buffer A from 0.9M to
0. 7ml fractions were collected and analysed for activity and protein concentration:

Fractions 22-24 were combined, total 37mg and 81U of activity and volume was reduced to 1.2
ml using Viva Spin concentrator 30000MWCO.
SEC: Sample was applied on a 16x60 HiLoad Superdex200 column equilibrated in 50mM tris-
HCl buffer pH 8.5. Gel filtration was done at flow rate 1.45ml/min. 2ml fractions were collected
(see chart below).

94
A280

2 3 4 5 6 7 8 9 10 11 12 13 14 fractions

10 20 30 40 50 60 70 80 ml

Three peak fractions (10-12) were combined (18mg of total protein) and applied on a 10ml
column with Red-Sepharose (Pharmacia) at flow rate 1ml/min. Column was washed with 15ml
of buffer 50mM tris-HCl pH 8.5 and then eluted with 1mM NADH in the same buffer:

[Protein] 1.5
A280 mg/ml

1.0

0.5

5 10 15 fractions

Fractions 14 and 15 with the highest protein concentration were combined


(10mg in total).

95
Purification process was analysed by checking specific activity on each purification step (see
table below) and also by SDS-PAGE (4-12% BT Novex gel)

Progress of purification of PheDH from Nocardia

Protein Activity Specific Total protein Total Yield


concentration U/ml activity mg Activity %
mg/ml U/mg U
CFE 28 2.75 0.09 2400 220 100
DEAE 5.6 1.45 0.26 660 171 75
AS cut 3.7 2.05 0.55 277 152 69
BTP 2.85 6.3 2.2 37 81 37
GF 2.4 7.1 3.0 18 54 25
Red 1.5 6.4 4.4 10 44 20
Sepharose

1 2 3 4 5 6 7
1. CFE Mark 12 MW
standards
2. DEAE-Sepharose
3. AS cut
4. Butyl-Toyopearl
5. Gel filtration
6. Red Sepharose
7. Mark12 MW standard

Lessons learned about Dye chromatography

Condition for binding should be optimised.


In case of PheDH from Nocardia:
 Buffer – 50mM tris-HCl pH 8.5, no salt
 Amount – 1.5mg of PheDH/ml of matrix maximum
 Sample volume – do not exceed column volume
 Bio-specific elution is preferable. Better to use higher concentration of
ligand. 3mM NADH elutes about 10% more enzyme than 1mM.

96
Glutamate dehydrogenase from Clostridium symbiosum again
Dye chromatography versus three step purification protocol
Unlike majority of NAD-binding proteins Glutamate dehydrogenase from Clostridium
symbiosum does not bind to commercial Red Sepharose which has Procion HE-3 dye cross
linked.
However it can be purified using different red dye, Remazol red (Syed et all., 1991, BAA,
v.1115, p. 123)

Procion HE-3 NAD Remazol red

Purification of GDH from C. symbiosum using Remazol red pseudo affinity


chromatography
Remazol-Sepharose was prepared as follows:
200ml of Sepharose 6B were washed with water to remove ethanol, suspended in 700ml of water. 1.9g
of Remazol red was dissolved in 200 ml of water and added to Sepharose. The mixture was incubated for
30 minutes with occasional stirring. 100ml of 20% NaCl was added and incubated for next 30 minutes.
Then 5ml of 5M NaON was added and left for 4 days with occasional stirring. The matrix was placed in
the column and washed with water, 6M Urea, 1M NaCl and 10 volumes of water. Matrix was taken
from the column and used to make columns of an appropriate size. We use 2ml columns packed with
Remazol-Sepharose in practical classes for undergraduate students in GDH purification experiment.
We found that maximal capicity of our matrix is about 0.5mg of GDH/ml. However capicity
seems was declining with every use of the column.
Biospecific elution which was succesfully applied for purification of PheDH from Nocardia
(see chapter above) was proved to be not cost effective as it required at least 5mM of NADH to
complete elution while resulting prep was not of that “ 100%” purity as we obtained for PheDH.
So elution was performed with 1M NaCl as in original Syed at al. paper.
Analytical purification on 2ml Remazol-Sepharose column went very well.
0.25ml of CFE (C=8mg/ml, Specific activity 11u/mg (2mg, 22U)) prepared in 0.1M KP pH 7.0
buffer (buffer K) was applied on a 2ml Remazol-Sepharose column (made in PD-10 column).
1ml fractions were collected.
Column was washed with 6ml of buffer K and then GDH eluted with 1M NaCl in buffer K.
Activity was checked in fractions. Some of the activity was found in unbound material and
wash. Majority of activity was found in elution fraction.
The balance of activity and total protein was found to be:
Total activity Total protein Specific activity
Unbound and wash: 2u 1.4mg 1.4u/mg
Elution: 19u 0.55mg 34.5u/mg

So, 1.95mg (97%) of total protein and 21u (95%) of activity was recovered.
Column seems was overloaded with GDH, so, capicity of matrix was about 0.25-0.3mg GDH
per ml.
97
Preparative purification:
Three step protocol (see Show cases, cases 3 and 4) versus Remazol-Sepharose

CFE prepared in KP pH 7.0 buffer was defrosted and filtred through 0.45µ filter:
V=12ml, C=6.7mg/ml
CFE was divided in two portions, 6ml (40mg of total protein) each.
Three step protocol
Anion exchage chromatography: 40mg of CFE was diluted three fold and applied on a 5ml
DEAE FF cartridge in buffer 20mM KP pH 7.0. Elution was performed by 50ml of gradient of
NaCl concentration from 0 to 0.5M. 2.5ml fractions were collected and analysed for activity (see
case 4 for assay composition).

Active fractions 14-19 were combined, V=15ml, C=1.3mg/ml, 19.5mg, suplimented with 1M
ammonium sulphate and applied on a 5ml Phenyl-HP cartridge.
Hydrophobic chromatography: Elution was done by 50ml of reverse gradient of AS
concentration from 1-0M in 20mM KP pH 7.0. 2.5ml fracttions were collected.

Based on elution profile fractions 21-24 were combined, V=10ml, C=0.67mg/ml, 6.7mg
Volume was reduced using Viva Spin with MWCO 50000 to 1ml, C=5.4mg/ml, 5.4mg.
Gel filtration : Sample was applied on a gel filtration column (1.6x60 HiLoad Superdex200)
equilibrated in 0.5M NaCl, 50mM tris pH 8.0 (standard GF buffer).
Flow rate 1.5ml/min.2ml fractions were collected.

98
Fractions 8-10 were combined: V=6ml, C=0.56mg/ml, 3.4mg ( Final prep 3sp)

Remazol-Sepharose purification
20ml column was made for purification. Preliminary experiments have shown that new unused
matrix have capicity about 0.5mg GDH per ml of matrix, so expected output from this column
could be up to 10mg.
Dye chromatography: CFE (6ml, 40mg of total protein) was applied on a 20ml Remazol-
Sepharose column eqilibrated with 0.1M KP pH 7.0 at flow rate 3ml/min. Column was washed
with 30ml of the starting buffer and then GDH eluted with 1M NaCl in the same buffer. 5ml
fractions were collected.

Fractions were analysed for activity. No activity was found in fractions 2-11. Fractions 12-14
with all activity were combined: V=15ml, C=0.56mg/ml, 8.4mg
Gel filtration: Sample was reduced in volume to 1ml (C=7.5mg/ml) and additional gel filtration
step was applied. All conditions as above.

99
Fractions 8-10 were combined: V=6ml, C= 0.9mg/ml, 5.4mg (Final prepRS)

SDS-PAGE analysis: 4-12% NuPageBT Novex gel

1 2 3 4 5 6 7 8 Mark 12 MW
standards
1. Mark12
2. CFE
3. After DEAE column
4. After Phenyl-HP column
5. GF loading
6. Final prep 3sp
7. Fr 12-14 Remazol Sepharose
8. Final prep RS

When compare line 6 (3 step protocol) with line 7 (Remazol-Sepharose prep) we can see that
purity of the first one is noticeably higher. After additional GF step for the RS prep there still are
a number of small contaminating bands, but purity now looks a little bit higher than for 3 step
prep.

Activity analysis
Despite simplicity of performing the activity assay there is a significant problem when we want
to measure activity accurately to obtain reliable figures for specific activity to compare different
enzyme preparations. The problem is that kinetics of the reaction in this case is not linear and so
it is practically impossible to measure initial velocity. It is also seems that NAD concentration is
not saturating under commonly used activity assay protocol (1mM NAD, 20mM NaGlu, 0.1M
KP pH 7.0). I found that saturated concentration is 10mM NAD.

100
To achieve more or less linear kinetics under the standard assay conditions the concentration of
enzyme has to be as low as it practically possible.
I found that the best way to compare activity of different samples is to dilute them in order to get
similar and relatively low activity around 5u/ml. Kinetics becomes almost linear in this range.
In my experiments I used spectrophotometer which could be programmed to make calculations
of activity. I have prepared a number of dilutions of the enzyme sample to get readings around
5u/ml and then I used dilution factor to calculate activity in the original sample. Data obtained
this way are presented in the table below.

V C Total Act Sp. Total Yield Purity by


ml mg/ml mg u/ml Act act % SDS-
u/mg u PAGE
CFE 6 6.7 40 67 10 400
DEAE 15 1.3 19.5 16.1 12.4 242
Phenyl-HP 10 0.67 6.7 16 23.8 160
GF load 1 5.4 5.4 145 26 140
Final Prep3sp 6 0.56 3.4 16.6 30 100 25 90%
Fr12-14 RS 15 0.56 8.4 17.4 31 260 65 80%
Final prep RS 6 0.9 5.4 35.4 39.4 212 53 95%

Verdict
Yes, yield with one step purification is significantly higher, while purity is lower. The strange
observation is that Specific activity of the two preps is the same, while purity estimated by SDS-
PAGE is higher with 3step protocol. The reason probably is that not all molecules of GDH are
active and so have not got affinity to Remazol.
Still with the preparative red column the yield was not as high as for small analytical run.
However analytical experiment result was too good to be true.
So, if you have ready remazol column of appropriate size, it is better to go for Remazol
protocol. In case if you only need to purify this protein once or twice, the amount of time and
effort to make the Dye column is not worthily.
Another issue is the Specific activity. In my hands under the same conditions as reported in
foundation Syed at al. paper Specific activity for clostridium GDH purified by Remazol
Sepharose falls in range 30-35u/mg, while they reported figure just 18.3u/mg. This is because
real initial velocity is really difficult to determine for this GDH. The lesson I took from this
experience was do not take Specific activity reported in the papers too seriously.
Also here rises the question:
Can Specific activity be good measure for purity as it was taken in the past? (For sure, prep on
line 6 does not look to be 25% less pure then the prep on line 8)

101
6. DNA binding proteins
Typical Heparin purification: RuvC from phage bIL67
Ruv C proteins are crossover junction endodeoxyribonucleases (nucleases that resolves Holliday
junction intermediates in genetic recombination).
RuvC from phage bIL67:
MW 18097 (dimer)
pI 7.64
Large scale purification
CFE was prepared in buffer 50mM tris pH 8.0, 0.25M NaCl from 7.5g of cell paste. Extra
sonication cycle was applied and centrifugation time was extended in order to obtain CFE at
higher than usual concentration.
CFE: V=42ml, C=12.5mg/ml, 525mg
Heparin Chromatography. CFE was applied on 5ml Heparin HP cartridge. AKTA purifier
system was used for purification.
Flow rate 5mg/ml. Fractions 2.5ml. Gradient: 75ml (15CV) 0.25-2M NaCl in 50mM tris pH 8.0

Fractions were analysed for protein concentration and fractions with highest concentration
20+21 were combined: V=5ml, C=10mg/ml, 50 mg
Volume was reduced to 2ml using VivaSpin MWCO 10000: V=2ml, C=23mg/ml, 46mg
Gel filtration. Sample was applied on a 1.6x60cm HiLoad Superdex200 column equilibrated in
0.5M NaCl 50mM tris pH 8.0 buffer. Flow rate 1.5ml/min. Fractions 2ml
.

Apparent MW
40kDa

102
Fractions 7-9 were combined: V=6ml, C=6mg/ml, 36mg

Purification progress was analysed by SDS-PAGE using NuPage 4-12% BT Novex gel:

1 2 3 4

1. Mark12 Mark 12 MW
2. CFE standards
3. GF loaded
4. Final prep

Summary:

This is an example of typical purification of DNA-binding protein. Often Heparin +GF protocol
works satisfactory allowing to produce 80-90% pure protein suitable for structural studies.
Good expression level and relatively high affinity to Heparin allow to purify RuvC
endonuclease to purity of about 90% .

103
Playing with solubility: LrpC from Bacillus subtilis

LrpC is HTH-type transcriptional regulator.


MW 16450, forms a tetramer
pI 7.6
LrpC is one of relatively rare proteins which have very sharp dependency of its solubility upon
the salt concentration. Solubility of LrpC in low ionic strength buffer (without salt) is practically
zero, while in the presence of 1M NaCl it is over 50mg/ml. This property was used to develop
optimal purification protocol.

LrpC was over expressed in [Link] cells to a good level (10% or higher).
Cells were disrupted in 50mM tris-HCl pH 8.0 buffer and pellet was collected by centrifugation
as usual (Protocol 2).
CFE contained 700mg of total protein and had practically no LrpC (see resulting gel).
Extraction of LrpC from cell debris. Pellet was suspended in 7ml of buffer with 1M NaCl,
50mM tris-HCl pH 8.5. Sample was stirred for 1hour at 4oC. Insoluble material was spun down
at 70000g for 10 minutes. Supernatant fraction contained 90mg of total protein (V=9ml,
C=10mg/ml)
Precipitation of LrpC with ammonium sulphate. 14ml of 4M AS was added to bring AS
concentration to 2.5M. LrpC precipitated and was collected by centrifugation as above. Pellet
was dissolved in 7ml of 50mM tris pH 8.0 and clarified by centrifugation as above.
V=8ml, C=11mg/ml, 88mg (about 0.3M AS).
Gel filtration. Sample was divided to 3 portions and gel filtration was performed on 1.6x60cm
HiLoad Superdex200 column equilibrated in buffer 50mM tris-HCl pH 8.0, 1M NaCl
2ml fractions were collected in the same set of tubes for each of 3 runs.
Fractions 14-19 were combined: V=35ml, C=2mg/ml, 70mg. Purity estimated by SDS-PAGE
was better than 90% (see gel below).

Apparent MW
78kDa

1 2 3 4 5 6
Purification progress was analysed by SDS-PAGE, using
NuPage 4-12% BT Novex gel:

1. Mark12
2. CFE obtained in 50mM tris-HCl pH 8.0
3. Cell pellet suspended in 1M NaCl
4. 1M NaCl extract (after centrifugation)
5. GF load (2.5MAS pellet dissolved and clarified)
6. Final prep

104
Heparin and solubility:
FrmR from Escherichia coli
FrmR is transcriptional repressor, sensor for formaldehyde.
MW 10318 Da, forms tetramer
pI 5.84
FrmR comes to me with the purification protocol which included Heparin chromatography,
ammonium sulphate precipitation and gel filtration. I was told that protein needs 0.3M of NaCl
to stay in solution and 10mM DTT and EDTA to keep it active. I quickly found that FrmR has
low affinity to Heparin column at 0.3M NaCl and in order to have it bound to the Heparin-HP
cartridge I had to decrease NaCl concentration to 0.1M. No FrmR was precipitated. In fact
0.3M NaCl appeared to be eluting concentration. Later I decided to simplify my life by
exclusion of DTT and EDTA from gel filtration buffer and started to run gel filtration in our
standard buffer 0.5M NaCl 50mM tris-HCl (so I saved 2 hours on equilibrating - re-
equilibrating the column). It did not affect activity. So I decided to try to remove DTT and
EDTA from the purification what so ever. Once again, as for a number of proteins before,
DTNB reaction proved that all 4 cysteins in the FrmR preparation were reduced despite absence
of DTT during purification. The protein was active and we have good publication on the
structure-function of this protein.
However, preparations of FrmR purified by Heparin–GF two step protocol contained significant
amount of 40kDa contamination (see gel below)

1 2 3 45 1. Mark 12
2. Cell Debris
3. CFE
4. After Heparin
column
5. Final preparation

To improve purity I decided to try to use low solubility of the protein at low salt conditions.
Dialysis in 50mM tris-HCl pH 8.0 buffer was performed on a sample obtained after Heparin
chromatography and majority of FrmR went out of solution in form of micro crystals. However,
it appeared that for successful crystallisation FrmR protein concentration has to be at least
3mg/ml, otherwise significant amount of FrmR was left in solution. Also crystallisation was
found to be temperature depended, so dialysis was performed at 4oC. Crystals were collected by
centrifugation and dissolved in 50mM tris buffer pH 8.0 containing 1M NaCl. Solubility under
these conditions appeared to be more than 40mg/ml. For the best result sample was gel filtered.
Purity of the resulting preps was typically better than 90-95%. To prevent crystallisation or
precipitation final preparations obtained at high concentration in the presence of 0.5M NaCl had
to be kept at room temperature.
Typical purification is presented below.

105
FrmR purification 30.3.16

Cells obtained from 1l culture were used to prepare CFE in buffer 0.1M NaCl, 50mM tris-HCl
pH 8.0 by a standard protocol (Protocols, 2).
CFE: V=15ml, C=7.5mg/ml, total protein 110mg
Heparin chromatography: CFE was applied on a 5ml Heparin-HP cartridge equilibrated in the
same buffer. Chromatography was performed on AKTA purifier system at flow rate 5ml/min.
Elution was achieved by 50 ml of gradient of NaCl concentration from 0.1 to 0.7M in 50mM
tris-HCl pH 8.0 buffer. 2.5ml fractions were collected.

Fractions were analysed for protein by method of Bradford and peak fractions 13-15 were
combined: V= 7.5ml, C=3.3mg/ml, 25mg.
Crystallisation: Protein concentration in this case was high enough and so sample was
subjected to dialysis without additional concentrating.
Sample was dialysed against 0.5l of 50mM tris-HCl pH 8.0 (Buffer A) over night in the cold
cabinet (at 4oC).
Micro crystals were collected by centrifugation (5 minutes 21000g) and dissolved in about 1ml
of 1M NaCl in Buffer A: V=1.6ml, C= 8.55mg/ml, 13mg
Gel filtration: Sample was applied on a 16x60HiLoad Superdex200 column equilibrated in
Buffer A +0.5M NaCl. Gel filtration was run at flow rate 1.5ml/min. 2ml fraction were
collected.

Apparent MW
45kDa

106
Fractions 7-9 were combined: V=6ml, C=2mg/ml, 12mg
FrmR was concentrated using VivaSpin with MWCO 30000:
V=0.43ml, C=18.5mg/ml, 7.8mg

SDS-PAGE analysis:
NuPage 4-12% BT Novex gel with MES running buffer:

1 2 3 4 5 6
1. Mark12
2. CFE
3. After Heparin column
4. Supernatant fraction after dialysis
5. GF loading (micro crystals dissolved in 1M NaCl)
6. Final preparation

Purity about 90-95%


Yield: 12mg from 1 litre of culture
11% of total protein
This is surprisingly high yield, as expression level
on the gel does not looks higher than 5%

Mark 12 MW
standards

107
Real power of Heparin: Human Flap endonuclease

Over the years we worked with a number of Flap endonucleases from different organisms
in collaboration with Dr Sayers from Medical school. Typically for crystallisation they
were purified using Heparin-GF or Heparin-IEC protocol. Most of them were over
expressed in [Link] to a reasonable level (at least 2-3%, so you can see the band in CFE
sample on SDS-PAGE). Human FEN was different as expression level was low and
practically insoluble, so it was impossible to identify certain band corresponding to FEN
in CFE on SDS-PAGE gel.
hFEN
MW 42593Da
pI 8.8

This protein is also interesting as it came to me with the most ridiculous purification
protocol I have ever seen.
Cells were suspended in tris buffer pH 8, 2mM EDTA, 0.2M NaCl and 5% glycerol.
Lysozyme (0.2mg/ml!!!!) was added and cells incubated for 20 minutes on ice
PMSF (23µg/ml) was added and cells were incubated 40 minutes at room temperature
Na-deoxycholate (0.5mg/ml) was added and incubated for 20minutes at room temperature
DTT (1mM) was added and incubated for 5 minutes
Sonication: 20% amplitude, 5sec bursts for 30 sec (not sure what that means???), repeated
three times
Centrifugation: 25000rpm at 10oC for 20 minutes
Ammonium sulphate was added to 0.5M
5% PEI (Polyethylenimin) precipitation was performed with mixing for 10 minutes
Pellets were removed by centrifugation at 25000rpm for 15 minutes
Supernatant was dialysed in buffer 20mM KP pH 6.0, 1mMDTT, 2mM EDTA, 5%
glycerol at 4oC over night
Heparin chromatography (0.1-1M NaCl gradient in above buffer)
Fractions with FEN were pooled and a 55% AS precipitation was performed for 2h at 4oC
Pellets were removed by centrifugation and supernatant fraction was dialysed in 20mM
tris buffer pH 8, 1mM DTT, 2mM EDTA, 5% glycerol (I guess overnight)
The sample was run trough Q column and unbound fraction was collected.
Sample was dialysed again in KP buffer pH 6.0, 50mM NaCl
Sample was applied on a combination of HiTrap SP and Heparin columns
No details how proteins were eluted. !!!!
It seems, the purification takes four days. It includes many manipulations of unclear
purpose and looks like mixture of ritual actions and sporadic desperate moves...
We purified it by Heparin-Cation Exchange Chromatography to about 85% purity, good
enough for successful crystallisation.

hFEN purification
6g of cells were defrosted and CFE was prepared in about 40ml of buffer 0.2M NaCl
50mM tris-HCl pH 8.0. The standard protocol was amended due to high concentration of
cell suspension: sonication was performed in three cycles instead of two and
centrifugation was run at 70000g for 15 minutes instead of ten.
CFE: V=35ml, C=11mg/ml 380mg

108
Heparin Chromatography. CFE was applied on a 5ml Heparin-HP column. Flow rate
4ml/min. 2.5ml fractions were collected. Elution was performed by 75ml gradient of 0-1M NaCl
concentration in 50mM tris-HCl pH 8.0 buffer.

Fractions were analysed for protein by method of Bradford and by SDS-PAGE.


Fractions 20-23 containing hFEN were combined: V=10ml, C=1.4mg/ml, 14mg
Preparation for cation exchange chromatography. hFEN has pI 8.8 and is suitable for cation
exchange chromatography. To allow hFEN to bind to SP matrix it has to be prepared at pH 6-
6.5 and as low salt as possible. hFEN was eluted from Heparin column with about 0.35M NaCl
50mM tris pH 8.0. To avoid over night dialysis, concentration and dilution technique was
employed.
Sample was concentrated using VivaSpin device to V=1.4ml, C=8.3mg/ml, 11.6mg
and then it was diluted in 30ml of 50mM MES-NaOH buffer pH 6.3
Some of the proteins precipitated and was removed by centrifugation at 70000g for 10 minutes.
Supernatant fraction: V=30ml, C=0.28mg/ml, 8.4mg
Cation Exchange Cromatography. Sample was applied on a 6ml Resource S column. Flow
rate 4ml/min. Fractions of 2.5ml were collected. Elution was performed by 60ml gradient of
NaCl concentration from 0.05 to 0.25M in 50mM MES buffer pH 6.3

hFEN elutes with about 0.1M NaCl.


Fractions 14+15 were combined: V=5ml, C=0.53mg/ml, 2.6mg
109
Purification progress was analysed by SDS-PAGE (4-12% NuPage BT Novex gel)

1 2 3 4 5 6 7 8
Mark 12 MW
standards
1. Mark12
2. Cell debris
3. CFE
4. Heparin unbound fraction
5. Heparin fr20-23
6. Pellet occurred at pH 6.3
7. Sample applied
on a Resource S column
8. Fr 14+15 from Resource S
(final preparation)

Purity of the final preparation is about 85%. Yield is 2.6mg. Presuming 2 step purification
has typical yield 50%, there was about 5mg of hFEN in CFE, which is 1.3%
(5:380=0.013).
As you can see on gel there is some hFEN in cell debris, but it is difficult to find right
band in CFE sample. Still, it was possible to purify hFEN to reasonable purity just in 2
step purification thanks to its affinity to Heparin and also its basic pI. It also was lucky to
get significant amount of contaminations precipitated at pH 6.3.

110
In need of nuclease treatment: SfsA
SfsA is sugar fermentation stimulation protein which function is positive regulation of
transcription, DNA-templated. We had studied structure of SfsA from two organisms,
Pyrococcus furiosus and Escherichia coli. This protein when over expressed in [Link] was
found to interact with DNA very strongly. Nuclease treatment was needed to make the whole
pool of TP to bind to Heparin, as described below.
However later we needed nuclease free sample for DNA-Protein complex studies. Ammonium
sulphate precipitation was employed with good degree of success (see below).
SfsA P. furiosus: SfsA [Link]:
MW: 26114 MW: 26229
pI: 9.3 pI: 6.5
A0.1%: 0.4 A0.1%: 1.14
We started our study with Pyrococcal SfsA.
First CFE was received from collaborators in 50mM NaPhosphate pH 8.0.
About 30mg of the CFE was applied on 1ml Heparin-HP cartridge and eluted with 20ml of 0-
1.5M NaCl gradient in Buffer A (50mM trs-HCl pH 8.0). 0.8ml fractions were collected and
analysed by Bradford and SDS-PAGE:
M12 CFE FT 10 12 14 16 18 20 22 24 26 Fr

As you can see a lot of TP flows through column unbound, M12CFE FT 15 16 17 18 Fr


some of it was eluted in fractions 16 to 20 by about 0.5M NaCl.
Fr.17-19 were combined, containing 2.2mg of total protein.
Rest of CFE was dialysed in 50mM tris pH 8.0, 2mM MgCl2
and 25u of Benzonase was added per ml of GFE. After 30 min
incubation at room temperature 30mg of CFE was applied on
the same column again. The result was similar to the untreated
sample. Rest of CFE was left for treatment over night at 4oC.
Chromatography was repeated with 30mg of treated CFE.
This time very little of TP was found in unbound material and
yield of TP in fr16+17 was 7mg.
For Pyrococcal protein it is logical to try heat treatment to 60 65 700C
M12CFE S P S P S P
improve purity. Analytical experiment was performed on CFE.
It was heated for 20 minutes at 60oC, 65oC and 70oC and
precipitated material was spun down. Samples were run on SDS-
PAGE. S-supernatant, P-pellet.
Best result was observed at 70oC.
As a second chromatography cation exchange was chosen as pI
of TP is 9.3. It was performed on Resource S column.
Refined protocol presented below.

111
SfsA from P. furiosus purification 12.9.11
CFE from 2litre culture cells was prepared in buffer 20mM NaCl, 2mM MgCl2, 50mM tris-
HCl pH 8.0, 250 u of Benzonase was added and sample was dialysed against above buffer at
4oC over night.
CFE after nuclease treatment ( V=31ml, C=4mg/ml, 124mg) was heated at 70oC for 20 minutes.
Precipitate was removed by centrifugation (70000g, 10 minutes).
Sample after heat treatment (V=31m,l, C=1mg/ml, 31mg) was applied on a 5ml Heparin HP
cartridge.
Heparin chromatography: Chromatography was performed on AKTA purifier system at flow
rate 5ml/min. Elution was done by 50ml (10CV) of gradient of NaCl concentration from 0 to
1.2M in BufferA. 2.5ml fractions were collected.

Fractions 20+21 were combined: V=5ml, C=3mg/ml, 15mg and concentrated using Viva Spin
MWCO 10000 to 1ml.
Cation exchange chromatography: Sample was diluted in 15ml of 50mM MES-NaOH pH 6.5
buffer and applied on a 1ml Resource S column. Flow rate 2ml/min. Gradient: 18ml, 0.25-0.7M
NaCl in above buffer. 0.5ml fractions were collected.

Fractions 18-26 were combined: V=4.5ml, C=2.6mg/ml, 11.7mg (final preparation)

Purification was analysed by SDS-PAGE (4-12% Nu Page Novex BT gel):

1 2 3 4 5 6 7 8

1. Mark12 Protocol was very effective


2. Cell debris even with lower expression
3. CFE level
4. Heat pellet Purity about 90%
5. Heparin load
6. Heparin flow
through
7. After Heparin
8. Final prep

Purity of final preparation is better than 90%


Yield is 9% of total protein, 5.5mg/ litre of
culture. Very good!

112
Similar protocol was applied for purification of [Link] SfsA except of heat treatment:
CFE→Benzonase treatment→Heparin→Resource S. Cation exchange chromatography worked
on [Link] SfsA protein despite its theoretical pI 6.5.

[Link] SfsA purification 8.9.11

CFE was prepared in 20mM NaCl, 5mM MgCl2, 50mM tris-HCl pH 8.0 buffer and treated with
Benzonase over night as described above.
CFE: V=35ml, C=2.45mg/ml, 86mg
Heparin chromatography. Flow rate 5ml/min. Gradient: 75ml (15CV) 0-1.5m NaCl in 50mM
tris-HCl pH 8.0. Fractions 2.5ml.

Fractions 16-19: V=10ml, C=2mg/ml, 20 mg


Sample was concentrated on VivaSpin MWCO10000 to 1.4ml and diluted with 30ml 50mM
MES-NaOH pH 6.5 buffer.
Cation exchange chromatography. Sample was applied on a 6ml Resource S column.
Flow rate 5ml/min. Gradient: 90ml (15CV) 0-0.25m NaCl in 50mM MES-NaOH buffer pH 6.5.
Fractions 2.5ml.

Fractions 31-33: V=7.5ml, C=1.4mg/ml, 10mg (final preparation)


SDS-PAGE analysis (4-12% Nu Page Novex BT gel):
1 2 3 4 5 6

1.Mark12
Purity of final preparation in this case is lower
[Link] debris than for Pyrococcal SfsA, about 80-85%, but it
[Link] is good enough for structural studies.
4. Heparin flow
through Yield is also good, 11% of total CFE protein
5. After Heparin
6. Final prep

113
Nuclease free purification of [Link] SfsA

CFE was prepared from 5g of cells in 1M NaCl, 50mM tris-HCl pH 8.0 buffer.
CFE: V= 30ml, C=10mg/ml, 300mg
Heparin chromatography 1: CFE was diluted 5 fold with 50mM tris pH 8.0 buffer and applied
on a 5ml Heparin-HP column. Chromatography was performed as described above yielded in
9.6mg.1ml Resource S column was used for the second chromatographic step producing 1.7mg
of the TP. Gel analysis revealed that SfsA was not pure and so gel filtration was applied for
further purification. SDS-PAGE analysis is presented below.
HepFT 1.5 2.0 2.5 3.0 3.5M AS pel
Only 0.3mg of TP was obtained
1 2 3 4 5 6 7
1. Mark 12 after GF with purity not better than
2. Cell Debris 70%.
3. CFE
4. Heparin flow
It was not enough material for the
through experiments and so attempt was
5. After Heparin made to purify TP from the Heparin
6. After Resource S
7. After GF
unbound material as it was a lot of
SfsA revealed in this fraction.
Analytical ammonium sulphate cut
(protocol 4) was performed on this
material.
SfsA starts to precipitate with 2.0M
AS and still is presented in 3.5M
pellet.
AS cut:43 ml of 4M AS was added to 65ml of Heparin 1 flow through fraction (2mg/ml, 130mg
of total protein) (1.8M AS). Precipitated material was removed by centrifugation (5 minutes at
70000g). 21g of AS powder was added to a supernatant fraction gradually with stirring at 4oC to
bring AS concentration to about 3.2M. Solution was incubated for 10 minutes and precipitated
material was collected by centrifugation as above. Pellet was dissolved in 40ml of 50mM tris-
HCl pH 8.0 buffer (conductivity 18.8mS/cm, total protein 80mg) and applied on a 5ml Heparin-
HP column.
Heparin chromatography 2: Chromatography was performed as described before.

Fractions 19-22 were combined, V=10ml, C= 0.72mg/ml, 7.2mg and concentrated to 1ml.
Cation exchange chromatography: Sample was diluted in 40ml of 50mM MES-NaOH pH 6.5
(8mS/cm) and applied on 1ml Resource S column. Flow rate 2ml/min. Gradient: 15ml(15CV)
0.05-0.3M NaCl in above buffer. Fractions 0.5ml. Fractions 22-24 were combined, yielded in
1.7mg of total protein

114
SDS-PAGE analysis (4-12% Nu Page Novex BT gel):

1 2 3 4 5 6 7

1. Mark12
2. Heparin 1 flow through
3. 1.8M AS pellet
4. 3.2M AS pellet
5. Heparin 2 unbound
6. After Heparin 2
7. Final prep

Application of AS cut was successful in attempt to purify SfsA without nuclease treatment.
However purity was not as good as for purification with nuclease treatment. In the final
preparation there is significant contamination and purity is not higher than 80%.
Nevertheless crystallisation of the above prep with DNA was successful and structure was
solved.

115
7. Tagged proteins
Proper use of a His-tag: Human protein PARP1 expressed in [Link]
Here is an example of purification of human protein PARP1. The level of expression of this
protein in [Link] cells is extremely low. The rough estimation of expression level comes to about
0.15-0.2% of total protein. No any band can be seen on SDS gel in CFE corresponding to
PARP1. Luckily the protein was His-tagged which allow me to purify it to acceptable purity in
just too steps.
PARP1 (PolyADP-ribose polymerase):
MW =113083,
pI 9.0
The protein has two attractive properties : High MW and basic pI.
Both gel filtration and cation exchange chromatography potentially can produce a good result. It
appeared that protein is dimeric and so gel filtration worked very well.
CFE from 1.5l culture was prepared as a standard procedure (sonication on ice 3x20sec at
16micron → spin down cell debris at 70000g for 10 min) in Buffer A+ 0.5M NaCl
Protein concentration was estimated by Bio-Rad assay.
CFE: V=35ml, C=7.5mg/ml, 260mg

Ni-NTA chromatography:Chromatography was performed on AKTA purifier system using a


5ml His-Trap column. CFE was applied and chromatography was run at flow rate 5ml/min.
Proteins were eluted by 50ml gradient of imidazole concentration from 0 to 0.5M in starting
buffer.
3ml fractions were collected.
BR For 20ul:
Fr A595
12 1.1
13 1.0
14 0.74
15 0.48
16 0.44
17 0.46
18 0.24
19 0.06

The elution profile revealed a bigger peak in fractions 10 to 12 (normally containing [Link]
proteins with low affinity to Ni ) and small peak in fractions 15 to 18, which presumably
contained His-tagged protein. Protein concentration in fractions was estimated by Bio-Rad
assay.
Fractions 16 -18 were combined: V=9ml, C=0.225mg/ml, 2.2mg

116
To prepare sample for gel filtration the volume was reduced using VivaSpin device with
MWCO 50000:
V=1ml, C=1.85mg/ml, 1.85mg
Gel filtration: Sample was applied on a 16x600 HiLoadSuperdex200 column equilibrated in
Buffer A. Flow rate 1.5ml/min. Fractions (V=2ml ) were collected after void volume.

Fractions 7-9 were combined: V=6ml, C=0.09mg/ml, 0.54mg.

Sample was concentrated using VivaSpin device (MWCO50000):


V=0.55ml, C=0.76mg/ml, 0.42mg
The purification progress was monitored by SDS-PAGE:
NuPAGE 4-12% BT Novex gel run with MES buffer

1 2 3 4 5 6

1. CD
2. CFE
3. Flow through Ni
column
4. GF loaded sample
5. Final preparation
6. Mark12

No band corresponding to purified protein


can be seen neither in cell debris nor in
CFE

Peak of PARP1 on GF column appeared at 53.4ml which corresponds to apparent MW of 280


kDa.
We can assume that PARP1 is an asymmetrical dimer in solution.
Purity of the final preparation is not ideal, about 70%, but it is good enough for the functional
studies. Yield is about 0.5mg. Presuming about 50% yield and 70% purity very rough
estimation of expression level is about 0.25%.
It seems, there is a degradation problem, so Protease Inhibitors have to be used during
preparation of CFE.
117
Removable tag: SAG19
SAG19 belong to group of Eimeria tenella surface antigens (SAGs). These proteins contain a
number of cysteins which form disulphate bonds. In order to express rightly folded molecules in
[Link] SAGs were fused with Therodoxin and expressed in Rossetta gami 2 strain. The construct
also contained two His6 tags , S-tag and cleavage site for enterokinase (EK): Trx-His6-S tag-
DDDDK-SAG19-His6. Obviously C-terminal His tag was not right thing to have and
complicated purification of cleaved SAG (instead of second Ni-column after cleavage we had to
use different method).
I chose to include this case to demonstrate protocols for handling of proteins with cleavable tags
and also to show that unspecific cleavage for highly specific protease is not an unthinkable
possibility.
SAG19 Trx-His6-S-tag-DDDDK
MW 26061Da 17075Da
pI 5.14 5.5

SAG19 purification

CFE was prepared by a standard protocol (Protocols, 2) in Buffer A (50mM tris-HCl pH 8.0)
Ni-NTA chromatography: CFE was applied on a 5ml HisTrap-HP column. Flow rate
5ml/min. Fractions 3ml. Gradient: 90ml of Imidazole concentration from 0 to 0.35M in
BufferA+0.5M NaCl.

Fractions 18-24 were pooled: V=21ml, C=2.75mg/ml, 57.8mg

Preparation for cleavage: Sample was concentrated on VivaSpin device with MWCO 30000
and diafiltration cap was used for buffer exchange to cleavage buffer (20mM tris-HCl pH 7.4,
50mM NaCl, 2mM CaCl2). Protein was concentrated to V=1.35ml, C=32.5mg/ml, 43.7mg

Cleavage: Preliminary cleavage experiments revealed that cleavage was not 100% specific, we
always observed additional bands on gel, but best results was when we use protein at high
concentration. Also, opposite to recommended EK : Protein ratio 1U : 20-100µg we used 1U
per 1.5mg of SAG19. Cleavage was performed at room temperature for about 16 hours
(overnight). Reaction was stopped by addition of 10mM of p-APMSF.

118
Purification of SAG19 (IEC): Protein concentration was checked in the sample after cleavage:
C=26mg/ml, V=1.35ml, 35mg
Sample was diluted in 10ml of Buffer A and applied on a 6ml Resource Q column.
Flow rate 5ml/min. Fractions 2.5ml. Gradient:120ml, 0-0.35M NaCl in Buffer A

Fractions were analysed on SDS-PAGE (4-12% Nu-PAGE BT Novex gel)


Mark 12
1 2 3 4 5 6 7 8 9 10 11 12 13 MW
1. Mark 12
standards
2. CFE
3. After HisTrap column
4. After cleavage (sample
applied on Resource Q
column)
5. Fr 11
6. Fr 13
7. Fr 15
8. Fr 18
9. Fr 20
10. Fr 22
11. Fr 24
12. Fr 26
13. Fr30
So, despite close pIs SAG19 and Trx tag were perfectly separated on Resource Q column
First peak elutes with about 0.07M NaCl and most likely contains fragments of Trx tag
Second peak elutes with about 0.1M NaCl and is composed of SAG19 (the protein with
apparent MW about 29kDa)
Third peak contains Trx tag and last small peak seems have some fragments which may be
misfolded SAG19.
Fractions 18-22 were pooled: V=12ml, C=0.72mg/ml, 8.6mg
Protein was concentrated to about 11mg/ml and used for crystallisation.

119
The Mass Spectrometry analysis had shown that the purified protein was shorter than expected,
24565Da instead of 26061. N-terminal sequencing revealed that main component of the prep
starts 15 aa residues later than predicted.

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAA
TKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGT*DDDDK**AMAAAPDFSSALSL
R↓SSTATSQQNSLSTNIFASGDVSPQTPTPPQADEKTEDCLAIINKLRSENLKDLLGTLAKAEDTEVTESLKAIKIEEPASPTAPKIA
VTLAGSNVDTCESGEGANAKKYPGLVIPFPHDTEFNCNALIQATYTAGLDHLKQSNFEPSTGTYDVENAPFNNVNASNVAFLLS
EKSKKVSCAATKDCKAGHDVLFCYFIDPLRKEDKPFTAELYNALWGLEALEHHHHHH

DTNB reaction under denaturing conditions did not revealed any reduced cysteins indicating
that protein was correctly folded. Structure was subserviently determined of the stable core of
the protein which was found to be even shorter (started peptide is shown in green) as further
degradation was observed during crystallisation.

So, this case revealed that specific protease may be not so specific. In case of SAGs EK is not
just was very active to cleave target protein at a number of sites different in structure to the
specific site, but Therodoxin tag, presumably well folded part of the construct seems was
cleaved as well. SAG19 was the best example among the SAGs, a number of other SAGs from
the same organism were destroyed by EK to a bunch of fragments.
In this particular case we had to use this kind of construct to produce specific eukaryotic
proteins containing disulphate bridges, but in vast majority of cases if tag has to be removed it is
better to try to express protein without tag rather than potentially have a trouble with unspecific
cleavage.

120
Cleaver use of tag: TssA from Burkholderia cepacia
TssA is one of the proteins which form Type VI secretion system. It is protein of 41kDa which
forms a big ring-like 32mer. The protein consists of about 30kDa N-terminal domain (NTD), a
long flexible linker and 8.5kDa C-terminal domain (CTD) which involved in oligomerisation.
Attempts to crystallise the whole protein did not succeed most likely due to flexibility of the
linker. NTD was expressed separately and structure was solved. Expression of CTD was 100%
insoluble. The clever move of Dr Mark Thomas was to fuse CTD to MBP (Maltose Binding
Protein) which is close in size to NTD. Linker between MBP and TssA CTD contained a
cleavage site for Factor Xa Protease. This approach works perfectly, huge soluble expression
was achieved and MBP-TssACTD forms oligomers of the same size as a native protein. After
MBP was cleaved off, TssA CTD rings were purified, crystallised and structure was solved.

TssA CTD (rings) purification


CFE was prepared by a standard protocol (Protocols, 2) in 0.2M NaCl, 50mM tris-HCl pH
8.0(starting buffer): V=20ml, C=4.5mg/ml, 90mg
Amylose chromatography: This chromatography was performed manually. 8ml column of
Amylose resin (NEB) was made in PD-10 column (see picture) and equilibrated in the same
buffer.

I have adapted a 20 ml syringe for sample


application with a spare cap for PD-10 column
and a piece of silicone tubing for a good seal.
Works fine, sample can be applied in one go,
no need to add sample ml by ml.

CFE was applied, unbound material was collected and column was washed with 20ml of the
starting buffer. Unbound material was V=21ml, C=2.2mg/ml, 46mg
Elution was achieved with 10mM maltose in the same buffer. 2-2.5ml fractions were collected
and protein concentration was estimated in them by method of Bradford:
For 2µl:
Fr A595
1 0 Fractions 2-5 were pooled:
2 0.1 V= 9ml, C=2.7mg/ml, 24mg
3 0.51
4 0.5
5 0.22
6 0.08

Amylose column was equilibrated with starting buffer again and unbound material was
reapplied on the column. The reason for doing this was my previous experience that not all MBP
fused protein would be bound to the column. It seems, binding conditions is not optimised.
Also, column is losing some amylose with each use and capacity decreases.
I would recommend doing second application, especially in case if expression level of MBP
fused protein is high.
121
Unbound material after second application: V=21ml, C=1mg/ml, 21mg.
Second set of eluted fractions was analysed for protein:
For 5µl:
Fr A595
1. 0
2. 0.65
3. 0.81 Fr 2-5: V=9.5ml, C=1.5mg/ml, 14.5mg
4. 0.5
5. 0.22
6. 0.1
Eluates from both runs were combined and concentrated using VivaSpin device with MWCO
50000: V=1.6ml, C=14mg/ml, 30mg
Cleavage: The sample was supplemented with CaCl2 (1.6µl of 2M solution) to make it 2mM.
150µl of 1mg/ml (150µg) of Factor Xa Protease (NEB) was added (5µg/1mg of MBP-CTD).
Incubation: overnight at room temperature.
Gel filtration: Sample was applied on a 1.6x60cm gel filtration column which was
Superdex200 in the past, but then it seems dextran moiety was destroyed and pores became
bigger, more like for Superose 6. I use this column when I have to purify big proteins.
Gel filtration was performed in buffer 0.5M NaCl, tris-HCl pH 8.0. Flow rate 1.5ml/min.
Fractions 2ml. Fractions were analysed for protein and by SDS-PAGE.

Apparent MW
250kDa

M12GFl 9 10 11 12 13 15 16 17 18 19 20 21 Fractions

Bradford: Fractions 10-14: V=10ml


For 10µl: C=0.72mg/ml
Fr A595
7 0.06 7.2mg
8 0.17
9 0.36 Uncleaved protein
10 0.61
11 0.7
12 0.61
13 0.4
14 0.2

122
As you can see on gel there is small amount of uncleaved protein which can not be separated
from the cleaved TssA CTD because uncleaved molecules forms oligomers alongside of the
cleaved ones. In our early attempts to crystallise TssA rings crystals did not difract well, most
likely due to heterogenity as a result of having one or two uncleaved molecules in the ring.
To fight this problem we introduced Amylose chromotography as a last purification step.
Amylose Chromatography: Sample obtained after gel filtration was diluted twice to reduce
salt concentration and was applied on a Amylose column. 2-2.5ml fractions were collected.
Column was washed with 10ml of starting buffer and then eluted with 10mM maltose in the
same buffer. All fractions were analysed by Bradford.
For 20ul:
Fr A595
1. 0
2. 0
3. 0.11
4. 0.25
5. 0.25
6. 0.24
7. 0.24
8. 0.23
9. 0.18
10. 0.09
11. 0.04
12. 0.05
13. 0.25
14. 0.1
15. 0.04
Unbound material was collected: fractions 3-9: V=19ml, C=0.3mg/ml, 5.7mg
Sample was concentrated, buffer exchanged and used for crystallisation. This time crystals were
better and stucture was solved.
The purification progress was analysed by SDS-PAGE: 4-12% NuPage BT Novex gel

Mark 12 MW
1 2 3 4 56 78
standards 1. Mark12
2. CFE
3. Unbound from second Amylose
chromatography
4. MBP-TssACTD
5. Cleaved sample
6. TssA CTD after gel filtration
7. Final prep
8. Fr 13 from last Amylose chromatography

Summary
As we can see on gel expression level of MBP-TssACTD is extremely high,
may be up to 40-50%. After second Amylose column there still is
significant amount of fused protein in unbound material...Are binding buffer
conditions optimal?
Cleavage on this occasion was not ideal and so sample contained noticeable
amount of uncleaved molecules. Small contamination of MBP also was left
in the prep of CTD rings after gel filtration.
Last amylose chromatography improved purity significantly. Some of the
rings probably containing one or two uncleaved molecules passed through
Amylose column unbound but it seems amount of such molecules was not
significant and crystals were ordered and diffracted well.
123
8. Special cases
Phosphoglycerate Kinase from Escherichia coli
I include this case to show that it is possible to purify protein from the natural source even if it is
not one of the main majors in CFE, but by chance has affinity to Heparin and also separates
nicely from other proteins on Resource Q column.
The story begins when I was asked to purify DNA binding protein called Rv3616c, which has
MW 39888 and pI 5.2. Protein was untagged and expression level was very low so no certain
band could be identified as a target protein. So strategy in this case is clear: Run Heparin
chromatography and find 40kDa protein as one of the significant or at least visible proteins in
eluted fractions. Second step is IEC and then depending on result, HIC+GF or just one of them.
If purification is successful in case like that we must to confirm identity of the protein (usually
by Mass Spectrometry).
Purification
CFE was prepared from about 6g of cells in Buffer A (50mM tris-HCl pH 8.0 ).
CFE: V=24ml, C=13mg/ml, 310mg
Heparin Chromatography. CFE was applied on a 5ml Heparin column.
Flow rate 4ml/min. Fractions 2.5ml. Gradient: 50ml 0-1M NaCl in bufferA.

Fractions were analysed by SDS-PAGE ( 4-12% NuPageBT Novex gel)


1 2 3 4 5 6 7 8 9 10 11121314 15 16
Mark 12
MW
standards

36kDa

This band of about 40kDa


looks convincing

124
Fractions 16+17 were combined: V=5ml, C=1.8mg/ml, 9mg
Anion Exchange Chromatography. Sample was diluted to 5mS/cm and applied on a 1ml
Resource Q column.
Flow rate 2ml/min, fractions 0.5ml.
Gradient: 10ml 0-1M NaCl in bufferA

Fractions were analysed by SDS-PAGE:

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Mark 12 MW
standards

Clear contender

Fraction 17: V=0.45ml, C=2.7mg/ml, 1. 2mg → GF

125
Gel filtration. Sample was applied on a Superdex200GL(24ml) column.
Buffer: 0.5M NaCl in bufferA
Flow rate 0.5ml/min
Fractions 0.5ml

Apparent MW
40kDa

Peak fractions 18+19 were combined: V=1ml, C=0.5mg/ml, 0.5mg

Apparent MW of 40kDa looks suspicious as DNA-binding proteins usually are dimers.


Sample was sent to Mass Spec and result was 40987Da, not 39757 as we would expect for the
target protein.
Further identification was performed by Mass Spec of tryptic fragments and it revealed that
purified protein was Phoshoglycerate Kinase (PGK) from [Link].
So, below is summary on purification of PGM from [Link]
1 2 3 4 5 Mark 12
MW
standards

1. Mark12
2. CFE
3. After Heparin
4. After IEC
5. After GF (final prep)

Purity is about 80-85%. Yield is 0.5mg from 310mg of total protein. Presuming 30% yield
from three steps purification protocol, PGK expression is about 0.5% of total cell protein.
What to say? PGK is a good protein to purify!
126
Low affinity chromatography: BPSL1958
BPSL1958 is one of proteins which found to be moderately important for the Burkholderia
pseudomallei virulence. When structure was determined it appeared to be sugar binding protein.
Further experiments revealed significant affinity of BPSL1958 to a number of sugars, including
glucose.
MW 36126
pI 4.38
A280 1mg/ml 2.13
For protein with pI 4.38 we expect that it has high affinity to anion exchange matrix. In fact
under our standard conditions of 50mM tris pH 8.0 this protein did not bind to DEAE column
properly and start to pass through the column in the end of sample application. We increase pH
to 9.0, but seems it did not help. In fact it was better interaction at pH 7.0!
So we decided to employ low affinity chromatography protocol.

BPSL1958 purification
CFE was prepared in 30mM tris-HCl buffer pH 7.0 using standard protocol, but with
modifications. The volume of CFE had to be reduced and so cells:buffer ratio was reduced, 3g
of cells were suspended in about 12 ml of buffer. Sonication was extended to 4 cycles of 20 sec
at 16micron amplitude and centrifugation was performed for 20 minutes at 70000g to
compensate for higher viscosity of the sample.
CFE: V=12ml, C=10mg/ml, 120 mg
Anion Exchange chromatography. Sample was applied on a 50ml column with DEAE-
Sepharose Fast Flow (1.6x25cm) equilibrated in the 30mM tris-HCl pH 7.0 at flow rate
5ml/min. 4ml fractions were collected. Column was washed with 75ml of the starting buffer and
then a 50ml gradient of NaCl concentration from 0 to 1M was applied to elute rest of the
proteins.
Fractions were analysed by Bradford (5ul)(presented on chart) and by SDS-PAGE (Laemmly,
12%)

M12 CD CFE 5 6 7 8 9 10 11 12 14 16 18 30 fractions

36kDa

127
BPSL1958 is one of those proteins which show low level of Bradford reaction. So figures of
A595 are low and do not really correspond to BPSL1958 distribution. So we would probably need
to run SDS-PAGE every time to find exact fractions with the target protein.
Luckily in this case we can use another quick method as we found that UV spectra are very
informative in this case.
UV spectra(240-340nm) were taken from the fractions 7-15:

As you can see fractions 11 and 12 display protein spectra, fractions 10 shows mix of protein
and nucleic acid while in other fractions nicleic acids are dominated. As we can see on gel
image, fractions 11 and 12 contain most pure BPSL1958.
In subsequent purifications we were taken spectra from relevant fractions to find 2-3 fractions
which show protein spectra and pooled them.
Fr 11+12: V=8ml, C=0.48mg/ml, 3.8mg (Bradford reaction)
Sample was concentrated using VivaSpin: V=1.4ml, C=3mg/ml (BR). Concentration also was
measured by UV (dilution 1:50):
For BPSL1958 A1mg/ml = 2.13
(0.48x50)/2.13= 11.2mg/ml
So Bradford reaction underestimate
BPSL1958 concentration almost 4-fold.
Total protein: 1.4ml x11.2mg/ml= 15.7mg

128
Gel filtration. Sample obtained after concentration was applied on a 1.6x60 HiLoad
Superdex200 column.
Buffer: 0.5M NaCl, 50mM tris-HCl pH 8.0
Flow rate 1.5ml/min
Fractions 2ml

Apparent MW
10kDa

Well, once again BPSL1958 displays unusual behaviour. Apparent MW from gel filtration is
10kDa instead of 36kDa. It seems, interaction with glucose residues in dextran moiety in the
Superdex beads delays its elution from the Superdex column!
Fractions 8-10 were pooled and UVspectrum was taken with 10 fold dilution:

A280=0.31

C= (0.31x10)/ 2.13= 1.45mg/ml

Fr 8-10: V=6ml, C=1.45mg/ml (UV), 8.7mg

Progress of purification was analysed by SDS-PAGE ( 4-12% Nu Page BT Novex gel):

Mark 12
1 2 3 4 5 Summary
1. Mark12
MW
standards 2. CD BPSL1958 is one of those odd proteins which
3. CFE display unusual behaviour in all possible ways:
4. GF load Having pI 4.4 it does not bind to anion exchanger
5. Final Being 36kDa it runs as 10kDa on gel filtration
prep column
It shows low signal in Bradford reaction
Expression of BPSL1958 was huge, but mainly
insoluble.
Thanks to low affinity chromatography main
purification was achieved on first step.
85-90% pure protein was obtained after 2 step
purification despite of low level of soluble
expression.

129
BacM from Myxococcus Xanthus

BacM is one of the weirdest proteins I ever got to purify. This protein forms filaments of a
different size so to purify protein we had to use urea to destroy them. Previously His-tagged
version of this protein was expressed in [Link] and it was purified by using Ni-column under
denaturing conditions and then urea was dialysed out resulting in BacM forming big aggregates
which came out of solution. Easy enough. But it was not easy for untagged BacM.
BacM : MW 13192, pI 8.2
BacM has no aromatic amino acid residues in its composition, so it displays no A280 absorbance.
Luckily it reacts with Bradford reagent!
Level of expression of BacM in [Link] was relatively low, about 3% or so.
Attempts to use cation exchange chromatography under denaturing conditions as a first step of
purification did not succeed. At pH 5 in 8M Urea BacM has very low affinity to SP-Sepharose. It
mainly passed through the small column in first instance. When I tried to apply a low affinity
chromatography it was bound to the bigger column and eluted in very first fractions of the NaCl
gradient together with a lot of contaminations.
So I attempted to do some separations under native conditions.
When cells were destroyed in 50mM tris pH 8.0 and CFE was prepared using our standard
centrifugation BacM was found in the pellet and in the supernatant. Decreasing speed of
centrifugation to 12000g and time to 5minutes we managed to keep all BacM in supernatant
fraction. We also get lucky with ammonium sulphate cut. All BacM precipitates by 1.5M
ammonium sulphate displaying some purification.
When AS pellet was dissolved in native buffer and run on gel filtration column BacM was mainly
found among particles bigger than 1000kDa, some smaller oligomers and also on monomers-
dimers position:
Mark 12
MW
standards

It was clear that upon this point we have to go under denaturing conditions.
So AS pellet was dissolved in 8M Urea and gel filtered in the presence of 7M Urea. Best
purification was achieved on this stage. However protein still was not pure. Best purity of about
80% or so was only reached after additional negative IEC and second gel filtration as described
below.

BacM purification 20.6.17


About 5-6g of cells were suspended in about 45ml of 50mM tris-HCl pH 8.0
Sonication: 3x20sec at 16 micron on Soniprep
Centrifugation: 12000g for 5min
CFE looked like a lot of DNA still is not destroyed. 3x10sec sonication was applied
Looks much better, less viscous.

130
CFE: V=48ml, C=11mg/ml, 520mg
37ml of 4M AS was added (to 1.7M) , incubated for 5 min on ice and spin down at 43000g for
10min. Supernatant fraction: V=80ml, C=3mg/ml, 240mg
2 pellets were obtained. One of them was placed on -20oC and saved for the next time.
To the second AS pellet 3ml of Buffer U (8M Urea, 50mM HEPES pH 7)was added
Extraction of BacM was performed by stirring the mixture for 1 h at room temperature
Insoluble material was removed by centrifugation at 70000g for 20min
Supernatant fraction: V=3.4ml, C=8.7mg/ml, 32mg
3ml was applied on GF column in buffer U. Flow rate 1.5ml/min, fractions 2ml

SDS-PAGE analysis (NuPage 4-12% BT Novex gel)


1. Mark12
1 2 3 4 5 6 7 8 9 10 111213 141516 17 2. CD Mark 12
3. CFE MW standards
4. AS super
5. AS pellet
6. Urea pellet
7. Urea extract
8. Fr 16
9. Fr18
10. Fr20
11. Fr22
12. Fr24
13. Fr26
14. Fr28
15. Fr30
16. Fr32
17. Fr34

Fractions 26-32: V=11.5ml, C=0.95mg/ml, 10mg


Sample was subjected for double negative IEC: 1ml Q-HP and 1ml SP-HP cartridges were
screwed together and equilibrated in buffer U
Flow rate 1ml/min, 2ml fractions were collected. Columns were washed with Buffer U, then
with Buffer U+1M NaCl

131
Fractions were analysed for protein and by SDS-PAGE:
BR 10ul:
Fr A595 M12 L 3 6 7 12 Fractions
2 0.22
3 0.32
4 0.3
5 0.35
6 0.34
7 0.3
8 0.04
10 0.0
11 0.04
12 1.2
13 0.24
14 0.04

Fr 2-7: V=11ml, C=0.45mg/ml


10ml, 4.5mg was concentrated on VivaSpin to V=0.5ml, C=5mg/ml, 2.5mg (out of 4.5!)

Sample was applied on a 24ml GF column equilibrated in Buffer U.


Flow rate 0.5ml/min, fractions 0.5ml
UV records failed on this occasion, so protein concentration was analysed in fractions and it is
shown on chromatogram below.

132
Fr 8-10 were combined:
V=1.5ml, C=0.33mg/ml, 0.5mg Final preparation

SDS-PAGE:
1 2 34 1. Mark12
2. Before last GF
3. Final prep
4. Second Urea extraction

Summary
Unfortunately for this purification I have not run gel to show purification progress, so below is a
combination of different gels:
1 2 3 4 5 6 7 8 9 10 Mark 12 MW
standards
1. Mark12
2. CD
3. CFE
4. AS supernatant
5. AS pellet
6. Urea pellet
7. Urea extract
8. After first GF
9. After negative IEC
10. After second GF
(final preparation)

GroES

Looking on gel for Urea extract we would estimate BacM to be about 10% or so, so having
32mg on this stage, we would expect to have about 1mg of pure protein after 3 step purification.
However, BacM kept disappearing even when left in an eppendorf in the presence of Urea.
Almost half of the protein was lost on VivaSpin device, presumably stick to a membrane. Only
0.5mg of the protein was obtained, very low yield with purity not better than 80%.
Also it seems significant amount of BacM was left in the pellet after Urea extraction. Second
extraction was attempted but extract was much less enriched in BacM than the first extract and
so it was dismissed.
Another unpleasant thing was that BacM co-purifies with another a bit smaller protein. It was
identified as GroES!!!?
So, I cannot say that purification of BacM was a great success.
However, I have managed to optimise purification by using the same buffer (Buffer U) for all
purification steps and achieved more or less acceptable purity. In this case, with very limited
options for chromatography, purity completely depends on level of TP expression.

133
Perfect purity:
Imidazoleglycerol-phosphate dehydratase 1 from Arabidopsis thaliana
IGPD takes part in histidine biosynthesis in plants and bacteria. It is a homooligomer of 24
subunits of about 22-29kDa . Enzyme contains Mn important for its activity. There are two
types of IGPD and Arabidopsis thaliana has both type 1 and type 2. Type 1 24mer dissociates
to stable trimers when Mn is removed in the presence of EDTA and associates to 24mer when
Mn is bound back.
Type 2 IGPD keeps its oligomeric 24mer form in the presence of EDTA and absence of Mn.
Thanks to such an unique property Type 1 IGPD could be purify to perfect 100% purity by
employing two gel filtrations: first gel filtration is performed in the presence of EDTA, trimers
are collected and then sample is supplied with Mn and subjected to gel filtration in the presence
of Mn to obtain 100% pure 24mer.
Type 1 IGPD from [Link] purification
CFE was prepared from 4g of cells in buffer A ( 40mM tris-HCl pH 8.0, 2mM EDTA) using a
standard protocol.
CFE: V=28ml, C=9mg/ml, total protein 252mg
Anion exchange chromatography
Sample was applied on a 20ml DEAE Sepharose FF column at flow rate about 4.5ml/min.
Chromatography was performed using peristaltic pump, UV monitor UV-1 Pharmacia and 2110
Bio-Rad fraction collector (see page 15). Elution was performed with 300ml of gradient NaCl
concentration from 0 to 0.5M in buffer A. 7.5ml fractions were collected.

Fractions were analysed for


protein by method of
Bradford and four fractions
with highest protein
concentration were
combined:
Fr 16-19: V=30ml,
C=2.2mg/ml,
Total protein 66mg

Ammonium sulphate precipitation

22ml of 4M ammonium sulphate solution was added to the sample obtained after IEC and so
IGPD was precipitated by 1.5M AS. Pellets were collected by centrifugation (5minutes at
45000g) and dissolved in 1 ml of buffer A: V=1.35ml, C=23mg/ml, 32mg.
First gel filtration
Gel filtration was performed on HiLoad Superdex200 column in buffer A+0.1M NaCl at flow
rate 1ml/min. 2m fractions were collected after void volume.

134
Fractions were analysed for
protein and four fractions
with highest protein
concentration were collected:
Fr 13-16: V=8ml,
C=2.5mg/ml,
Total 20mg
Volume of the sample was
reduced using VivaSpin
30000MWCO device:
V=0.6ml, C=29mg/ml,
17.5mg

Second gel filtration


The same column was equilibrated in buffer 20mM tris-HCl pH 7.5, 2mM MnCl2, 0.1M NaCl.
The sample obtained after first gel filtration was applied and gel filtration was performed under
the same conditions as the first one.

First peak was analysed by Bradford


and peak fractions were combined:
Fr 5-7: V=6ml, C=2mg/ml, 12mg
Sample was concentrated using
VivaSpin to prepare for
crystallisation:
V=0.33ml, C=30mg/ml, 10mg

Purification progress was analysed by SDS-PAGE (4-12% NuPage BT Novex gel)


Mark 12
1 2 3 4 5 6
MW
standards

1. Mark12
2. CFE
3. After AEC
4. Sample for the first GF
5. Sample for the second GF
6. Final preparation

135
FEN

BFL1
GDH

IGPD
RuvA

NheA FrmR

SfsA

RuvC
LrpC

136

You might also like