Protein Purification Protocols Guide
Protein Purification Protocols Guide
Second edition
2018
2
Contents
I. Introduction 7
II. General sequence of protein purification procedures 9
Preparation of equipment and reagents 9
Preparation and use of stock solutions 10
Chromatography system 11
Preparation of chromatographic columns 13
Preparation of crude extract (cell free extract or
soluble proteins fraction) 17
Pre chromatographic steps 18
Chromatographic steps 18
Sequence of operations during IEC and HIC 18
Ion exchange chromatography (IEC) 19
Hydrophobic interaction chromatography (HIC) 21
Gel filtration (SEC) 22
Affinity chromatography 24
Purification of His-tagged proteins 25
Purification of GST-tagged proteins 26
Purification of MBP-tagged proteins 26
Low affinity chromatography 26
IV. Protocols 41
1. Preparation of the stock solutions 41
2. Quick and effective cell disruption and preparation of the cell free extract 42
3. Protamin sulphate (PS) treatment 43
4. Analytical ammonium sulphate cut (AM cut) 43
5. Preparative ammonium sulphate cut 43
6. Precipitation of proteins by ammonium sulphate 44
7. Recovery of protein from the ammonium sulphate precipitate 44
8. Analysis of solubility of expression 45
9. Analysis of expression for low expressed His tagged protein 46
10. Bio-Rad protein assay Sveta’s easy protocol 47
11. Protocol for accurate determination of concentration of pure protein 47
12. Calibration plot for gel filtration column 48
13. Ni-chelating cartridges : cleaning and recharging 48
14. SDS PAGE Sveta’s easy protocol 49
15. DTNB reaction 50
16. Refolding protocol 50
3
V. Charts and Tables 51
Ammonium sulphate –Sugar refractometer 53
NaCl-Sugar refractometer 54
Calibration plot for Hi-load Superdex 200 column 55
Calibration plot at various salt concentrations for Superdex200 GL column 56
Ammonium sulphate table 57
Properties of amino acids 58
VI. Appendix 1 59
[Link] of protein concentration 59
[Link] to concentrate proteins 64
[Link] to store proteins 67
[Link] to estimate purity of a protein preparation 68
VII. Appendix 2 69
1. Prepare your solutions right! 69
2. Gel filtration 70
Separation by molecule’s size 70
Calibration plot 71
Main reasons for “abnormal” mobility of some proteins during 72
gel filtration
3. Time saving tips 73
4. Golden rules in protein purification 74
1. Two step purification protocol and a lesson to learn (BPSL 1549 (BLF1)) 75
2. It is easy with the coloured proteins! 79
Single-domain haemoglobin cgb from Campylobacter jejuni 79
Flavohemoprotein HMP from Escherichia coli 81
3. Almost typical three step purification (Glutamate Dehydrogenase from 85
Clostridium symbiosum)
4. Monitoring purification by enzyme activity (Glutamate Dehydrogenase 88
from Clostridium symbiosum)
5. Power and failure of dye pseudo affinity chromatography 91
Phenylalanine Dehydrogenase from Nocardia sp. 91
Glutamate Dehydrogenase from Clostridium symbiosum 97
6. DNA binding proteins 102
Typical Heparin protocol: RuvC from phage bIL67 102
Playing with solubility: LrpC from Bacillus subtilis 104
Heparin and solubility: FrmR from Escherichia coli 105
Real power of Heparin: Human FEN 108
In need of nuclease treatment: SfsA 111
7. Tagged proteins 116
Proper use of a His-tag: Human protein PARP1 expressed in [Link] 116
Removable tag: SAG19 118
Cleaver use of tag: TssA 121
8. Special cases 124
Phosphoglycerate Kinase (PGK) from Escherichia coli 124
Low affinity chromatography: BPSL1958 127
BacM from Myxococcus Xanthus 130
Perfect purity: IGPD from Arabidopsis thaliana 134
4
Abbreviations
AA acrylamide
APMSF 4-Amidinobenzylsulfonyl fluoride hydrochloride
AS ammonium sulphate
CBV column bed volume
CE crude extract
CFE cell free extract
CM carboxymethyl
DEAE diethylaminoethyl
DTNB Dithionitrobenzole
DTT dithiothreitol
EDTA ethylenediaminetetraacetic acid
FF fast flow
HEPES N-(2-hydroxyethyl)piperazine-N'-(2-ethanesulfonic acid)
HIC hydrophobic interaction chromatography
IEC ion exchange chromatography
MES 2-morpholinoethanesulfonic acid
MW molecular weight
MWCO molecular weight cut off
PBS phosphate saline buffer
PS protamine sulphate
PSA ammonium persulphate
PAGE polyacrylamide gel electrophoresis
Q quaternary ammonium
S methyl sulphonate
SDS sodium dodecyl sulphate
SEC size exclusion chromatography or gel filtration
SP sulphopropyl
TEMED N,N,N',N' tetramethylethylenediamine
TP target protein
UV ultraviolet
Contact details
Dr. Svetlana Sedelnikova
Department of Molecular Biology and Biotechnology
The University of Sheffield
Sheffield S10 2TN
Please, contact me by e-mail [Link]@[Link]
All your comments and questions are very welcome
5
With greatest respect and gratitude to my teachers
Prof. Alexander Sergeevich Spirin and
Prof. Marina Borisovna Garber
and people of Institute of Protein Research, Pushchino
6
I. Introduction
Why do we need to purify protein in one day?
After 25 years and 360 proteins it has become clear to me that for some proteins
even one extra day under conditions normally used for protein purification can
detrimentally affect their activity and crystallisation ability. Whilst the majority of
proteins can survive long purification and can be kept and stored at 4ºC for days
and even weeks with little loss in activity, it does them no harm to be purified in
one day either. To achieve the goal of complete protein purification in one day you
should move fast and choose appropriate protocols, avoiding long procedures such
as dialysis, long centrifugations and slow chromatography. Below are some
protocols and tips which help me to achieve this goal.
We also have to remember that tag as well as being often useful in some cases it
may be an obstacle that prevents correct proteins folding. I consider the recent
trend to do all expressions in a tagged form is misleading . For most of enzymes
and similar cytoplasmic proteins the chance to be successfully expressed is greater
in the absence of the tag. My recent experience also revealed that if the fusion
protein or the tag has to be removed from the target protein you may face a great
problem either with protease underperforming or unspecific proteolysis leading to
damage of the target protein.
In this second edition I have included my recent experience with purification of
the tagged proteins.
Please note that this brochure is not a complete guide to protein purification and
you should still read serious books on the theory of chromatography to become
familiar with the subject.
7
SDS-PAGE equipment
8
II. General sequence
of protein purification procedures
Gradient mixer
Eppendorf tubes
9
Preparation and use of stock solutions
It is very convenient to have stock solutions of the main salts and buffers used during
purification. Correctly and carefully prepared stock solutions can noticeably improve accuracy
and reproducibility of the purification procedures.
10
Chromatography system
Buffers Fraction
Samples Pump Column UV
__
Gradient monitor
collector
mixer
Chart recorder
PC
The simple chromatographic system consists of a peristaltic pump, a column and a fraction
collector. A gradient mixer is required if gradient elution of the proteins is used. Fractions are
analysed manually. More advanced systems include UV monitor usually monitoring an
absorbance at 280nm.
Modern systems such as the AKTA Prime and other AKTA types have a little bit different and
more complicated arrangement of the same parts. All compartments are integrated and centrally
controlled through a PC interface.
Please notice that the pump is placed before the column, not after as some people do. Don’t
place the horse behind the cart!
Electrolyte bridge
Sample
or buffer
Simplest
Gradient
Mixer
Stirrer
Column
Flow is
driven by Analysis of the fractions
gravity is done manually using
spectrophotometer and
gel electrophoresis
Manual fractions
collection
11
o Semi-automated systems (1960-80)
This system is an AKTA Purifier FPLC (Fast Protein Liquid Chromatography) machine. It is
operated by PC through UNICORN software and is highly automated. The feature I like most is
the way the chromatograms are saved and presented:
12
Cold cabinet vs room temperature
You may notice that our AKTA machine is not in a cold cabinet, and that the chromatography is
performed at room temperature while the earlier system is placed in the cold cabinet and
chromatography is done at 4oC. Some labs still put AKTA machines at 4°C (putting it at risk of
damage by condensation etc.). However, the reason that chromatography has historically been
done in cold rooms was to protect proteins from proteolysis during the days-long purification
processes. When proteins were purified from original sources purification procedure lasted for a
few days, one chromatography took a day or longer. It was vital to perform chromatography in
cold to slow down any possible proteolysis and bacterial growth. In contrast, the
chromatography performed on modern systems with 5ml cartridges lasts 20-30 minutes, and
combined with the use of low-proteolysis [Link] strains, the risk of protein degradation at room
temperature is minimal. So the most rational way is to do chromatography at room temperature
and place eluted fractions in the cold cabinet to prevent occasional bacterial growth in them.
Cleaning of chromatography system
It is extremely important to keep clean all parts of system ( tubing, pumps, sample loops etc.)
o Always pump water through all part of system after chromatography to prevent salt to be
crystallised in the tubes and channels.
o To prevent bacterial growth 20% ethanol wash is usually recommended. However it is
not 100% safe and sometimes bacterial growth still happens. In our lab we use 1-2mM
EDTA solution to keep AKTA systems between purifications. It never failed.
Pre-chromatographic steps
Some protein purification protocols include a treatment of the crude extract (CFE). This could be
dialysis, differential ultra centrifugation, addition of a reagent (such as substrates or inhibitors,
etc.) or precipitations of some components of crude extract using different precipitants.
Dialysis is normally required if CFE was obtained in the buffer which is not suitable for
the first chromatographic step
Differential ultra-centrifugation is applicable if the target protein (TP) is associated
with a certain part of the cell or with certain organelles. It is not necessary for purification
of soluble cytoplasmic proteins.
Fractionation of the cell free extract using various precipitants was a very popular
and powerful method in the early days when chromatographic techniques were not
properly developed. Ether, chloroform, ethanol, isopropanol and polyols were widely
used. Nowadays ammonium sulphate is practically the only precipitant that is frequently
used for fractionation of the CFE (in a so called ammonium sulphate cut procedure).
o Ammonium sulphate cut (see Protocol number 4 for the procedure) For this
application ammonium sulphate concentration is usually expressed in a % of
saturation. Saturated solution (100%) at room temperature is about 4.1M. Using
the ammonium sulphate table (see Tables and Charts section) you can find out
how much ammonium sulphate powder you should add to the solution to get a
desirable concentration. During precipitation the protein solution should be kept
on ice or at 4˚C to prevent proteins from denaturing due to heat produced by the
ammonium sulphate dissolving. After this step the protein sample will contain
significant amounts of ammonium sulphate and cannot be used directly for ion
exchange chromatography but can be used for hydrophobic chromatography (after
adjusting ammonium sulphate concentration to required level) or applied on the
gel filtration column for separation or desalting
o Clarification of crude extract by protamin sulphate treatment is another
method that can sometimes be useful. Protamin sulphate (PS) is used to
precipitate out nucleoproteins such as ribosomes and DNA/protein complexes. In
my work it has been particularly useful for clarification of fungal extract. After
PS clarification the sample can be used directly for any kind of chromatography
(see Protocol number 3 for the procedure).
Denaturing of contaminating proteins by heating has become a rather common
procedure that is especially effective if you are dealing with recombinant protein from a
thermophilic organism expressed in [Link]. If you know the denaturing temperature of the
TP, you can heat the crude extract for 10-20 minutes at temperature 5-10°C lower than
denaturing temperature. This process depends on pH, salt concentration and protein
concentration. Small-scale trials are required to optimise all conditions.
17
Chromatographic steps
Among about a dozen kinds of chromatography the most useful in protein purification are:
Purification (fold)
Ion-exchange chromatography (IEC) 2-10x
Gel filtration or size exclusion chromatography (SEC) 2-3x
Hydrophobic chromatography (HIC) 2-10x
Affinity and pseudo affinity chromatography >100x
To become familiar with the basic theory and methods in chromatography, please read the
useful booklets from GE Healthcare. They are accessible on the website and at minimum you
need to read these five:
Affinity chromatography. Principles and Methods
Ion exchange chromatography, Principles and Methods
Gel filtration, Principles and Methods
Hydrophobic interaction chromatography, Principles and Methods
Protein Purification Handbook
Tip: To save time on the chromatographic step do not wait until the elution is totally
completed. Start to analyse protein concentration in the fractions after collection of 15-
20 fractions or after about 1/3 of the gradient has been applied on the column.
18
Ion exchange chromatography
Please read “Ion exchange chromatography” booklet for theory and matrix characteristics.
Anion exchange matrixes and their standard columns:
Weak anion exchangers: DEAE-Sepharose Fast Flow, DEAE-Toyopearl 650S
Strong anion exchangers: Q-Sepharose Fast Flow or HP, Resource Q (HPLC), Mono Q (HPLC).
The latter two columns are high resolution columns which have fine beads and some
pressure is required to run them, therefore they are used with AKTA systems or the
FPLC system and often applied as a last polishing step.
Anion exchange chromatography is favoured as a first chromatographic step.
Normally we use DEAE-Sepharose FF and sometimes Q-Sepharose FF columns.
With AKTA system use HiTrap DEAE FF or HiTrapQ HP cartridges, just screw 2 to 4 of
them together if required.
Cell free extract prepared in Buffer A (50mM tris pH 8.0) can be applied on the column
directly, no extra preparation needed.
Altering column pH
The typical pH range for anion exchange chromatography is from 6 to 9.
Note that it is not easy to change pH of an ion exchange matrix. It would not work if you
simply try to wash column with the starting buffer of 50mM concentration at different pH. To
change pH in the column apply about ¼ CBV of 1M buffer solution of the desired pH,
following by 2 CBV of the starting buffer (with the same pH as the 1M buffer solution).
19
o Length of gradient is typically 10-30 CBV.
For the first step 10 CV is optimal which corresponds to 100-400ml for
a 10-40ml column.
For 5ml cartridges it is 50ml.
So the slop is 0.1M salt/1CV for weak (DEAE)
and 0.2M/1CV for strong exchanger (Q) matrixes.
For high resolution FPLC columns (e.g. MonoQ, ResourceQ) the slop
can be reduced to 30-50mM/1CV to achieve better separation
20
Hydrophobic interaction chromatography
Please read “Hydrophobic interaction chromatography” booklet for theory and matrixes.
Phenyl-Sepharose FF is readily reported in literature, but I found that Toyopearl 630 matrix
(TOSOH) is significantly over performing it in respect with peak sharpness and resolution.
With AKTA systems we use Hi Trap Phenyl HP cartridges because TOSOH does not
manufacture Toyopearl 630 cartridges suitable for use with AKTA systems. However Phenyl-HP
cartridges perform much better than Phenyl-Sepharose FF and so have been successfully used for
purification of a number of proteins in our lab.
GE Healthcare also produces 1ml and 6ml Resource ETH, Resource ISO and Resource PHE
FPLC columns. I have not find them very useful mainly because HIC is very rear used as a
polishing step.
21
Gel filtration (SEC)
Please read “Gel filtration. Principles and methods” booklet for theory and matrixes.
See also Appendix 2.2
The main feature of this type of chromatography is that it is zonal separation, so columns are
long and samples are small to allow zones to be separated properly.
Purification power of this step is not high. Generally speaking we could expect about half of
the contaminating proteins to be separated from the TP during this step. However for small
(<20kDa) and big (>400kDa) proteins, gel filtration is more effective and often provides a
significant purification.
It makes gel filtration a suitable polishing step that also provides additional information on
the oligomeric state of the TP and quality of the preparation.
In our lab we use Hi-Load Superdex 200 1.6x60cm columns from GE Healthcare
Total volume: 120 ml
Void volume (V0): 45ml
Separation range MW: 600KDa – 10KDa
Sample: volume 0.5-2ml, no restrictions on buffer composition
Loading: up to 50 mg of total protein (20 mg per protein for the best result)
Flow rate: 1-1.5 ml/min
Elution with continuous buffer (pH 5-10, salt concentration 0.1M or higher)
Collect 2ml fractions after void volume or start collection later if you know elution
volume (Ve) of the TP peak.
Take care with these expensive columns
Do not allow air to get into the column. If you do accidentally dry the column, even so
badly that cracks appear, do not panic and wash column with plenty of water at flow
rate 2-3 ml/min until all the air has been pushed out of it.
Time to time, after couple of dozen of runs, the net on the top adapter get partially
blocked and has to be replaced with the new one. Please, use the instruction in the
leaflet provided with the column (or find one on the Web). This is very important to do
it properly, do not damage all important top layer of the column bed. After drying event
especially and if the net replacement was not done to a perfection, a column
performance could decline a little bit (say losing 1000-3000 theoretical plates), but
normally still remains good.
Never ever try to repack those expensive columns!
According to my experience self packed columns never come close in performance to the ready
made ones. My best attempt to pack the column with the fresh loose Superdex200 prep grade
matrix was yielded in producing the column with resolution power of 8000 theoretical
plates/meter while for commercial columns the figure reproducibly is above 13000. Back then I
was not happy with my column and decided to repack it and had it done following all rules to
the scratch. The result was 5000 theoretical plates/meter.
Standard buffer for gel filtration in our lab is 50mM tris-HCl pH 8.0, 0.5M NaCl,
which is good for the majority of proteins.
Any other buffer at reasonable pH could be applied, just avoid low salt conditions. This
prevents absorption of proteins on the matrix.
If required, gel filtration can be used to exchange buffer in the protein sample for the
next purification step.
22
To estimate MW (molecular weight) and oligomeric state of your protein you can
use chart “Calibration plot for Hi-Load Superdex 200 column” (Tables and Charts
section). This chart was produced for the "standard buffer" (50mM tris pH 8.0, 0.5M
NaCl).
The slope of a calibration plot depends considerably on the salt concentration in the
elution buffer. See chart "Calibration plot at various salt concentration".
Gel filtration matrix may change its properties
Above calibration plot is typical for the 16x60Hi-Load Superdex 200 column and using it
for your MW estimation you most likely will get a fair result. Nevertheless be aware that
when column is in use for long time, after drying event or net replacement the separating
properties of the column could change. The most drastic change I noticed in a separation
properties of the Superdex 200 column was so big that the calibration plot of the column
became more like that of Superose 6 matrix. The only explanation I could give for this is
that dextran component of the beads was destroyed (probably by one of the “proteins of
unknown function” which was purified on the column).
Do calibrate your column each time when you want to estimate MW of your
protein. Run at least one mix of 4 calibration proteins in the same buffer as your
protein.
It is convenient to use Low Molecular weight and High Molecular weight Gel
Filtration Calibration Kits from GE Healthcare. Just follow the instructions in
the booklet. However these kits are expensive and you could use some other suitable
proteins for calibration. See “Calibration of gel filtration column” protocol.
Gel filtration is not an accurate method to measure MW or oligomeric state of
the protein. Proteins are separated by their size and not by MW. Proteins with the
same MW could have a different shape and compactness therefore their sizes and so
called Stock’s Radius could be different and so could the elution volume (Ve) and
apparent MW. Another possibility for misidentification is if the protein has some
affinity to the matrix and so elutes later than it should according to its MW.
23
Affinity chromatography
Refer to “Affinity chromatography. Principles and methods” for theory and applications.
In our daily protein purification routine we either use Pseudo affinity chromatography or
tag affinity chromatography to purify tagged proteins.
Pseudo affinity chromatography
We refer to Pseudo affinity chromatography when matrixes with cross-linked ligands
similar in structure to substrates of some enzymes are used for their purification.
24
Purification of His-tagged proteins
Among a number of tags in use the most common is 6xHis tag. Recently 10xHis tag is
developed, which is good news as it has higher affinity to Ni-matrix.
Ni2+ charged IDA (imminodiacetic acid) or NTA(nitriltriacetic acid) crosslinked to
agarose or Sepharose beads are used to fish His-taged protein out from the cell free
extract .
o There is a wide range of Ni2+ charged matrixes, readymade columns and cartridges
available from many companies. Among 3-4 brands which I have tried I’ve found
His Trap cartridges (GE Healthcare) to be the best with respect to their capacity
and separation power. They are convenient for use with the AKTA system, but are
relatively expensive and not easy to clean. In my practice typical life time is about
30 runs.
o It is at least twice as cheap to buy bulk imminodiacetic acid-Sepharose from
Sigma, make own columns of any size and charge them with Ni2+. It is good option
for making very small or big columns or for batch method.
Properties of the different brands of Ni-columns and matrixes differ significantly
Refine the elution conditions for your TP for any different brand or type of the Ni-
column used.
Conditions for Ni-beads chromatography
Buffers: mainly two types of buffer are used, PBS pH 7.4 and Tris-HCl pH 8.0. Also,
to suppress ion-exchange properties of Ni2+, 0.5M NaCl is normally included. Prepare
cell free extract in the same buffer.
Capacity of different brands of the Ni-beads noticeably vary from one to another, but the
most serious factor which contributes into Ni-beads capacity is His-tagged protein itself.
It seems that accessibility of His tag to Ni in the great degree depends on the protein
fold and so is amount of the TP which binds to the column. The highest capacity I have
observed was 30mg per ml of the beads, and lowest was just 2mg/ml. This also affects
the elution concentration of Imidazole.
Elution
To elute protein from a Ni-column continuous or stepwise gradient of Imidazole
concentration is used. According to my experience most of the His-tagged proteins elutes
with Imidazole concentration in range 0.05-0.5M. Most of them are eluted at 150-
200mM. In a couple of cases the elution concentration of Imidazole was higher than
0.5M.
Stepwise elution
People who have no chromatographic equipment have to purify His-tagged
proteins either by batch method or using syringe with cartridges. They only can
use stepwise elution, which could yielded in pure protein if level of TP expression
is high and concentrations of Imidazole on each elution step is optimized.
Continuous gradient elution
Much more reliable is a continuous gradient elution. It is convenient to use
AKTA system and His-Trap cartridges. Typically for a new protein it is useful
to apply a gradient of Imidazole concentration from 0 to 0.5M in 10CV. There are
a significant number of proteins in the cell extracts which have some affinity to
Ni. They elute from the cartridge with about 50-80mM Imidazole as a sharp peak.
Typically His-tagged proteins are eluted with higher concentration of Imidazole
as a second, wider peak. Some of the His-tagged proteins elute just after
contaminations and so the gradient has to be optimized, normally keeping 10CV,
but finish at 0.25-0.35M Imidazole. In some cases we have to apply 2-3CV of
30mM Imidazole wash to remove majority of the contaminating proteins before
applying the gradient or add 20mM Imidazole in lysis buffer.
Latest development on His-tag front is 10His tag. It may significantly improve binding of a TP
to a column and so improve purity of the preps on this stage.
25
Cartridge care
After a number of runs (10-30, depends on amounts of the cell free extract applied)
a cartridge became contaminated and flow rate significantly reduced. These cartridges
could be cleaned up using 1M NaOH (see Protocol “Ni-chelating cartridges: cleaning
and recharging”).
o In some labs people strip Ni with EDTA after each run or after a few runs. I do not
think this method is effective as contaminations stick to beads most likely
hydrophobicaly.
26
III. “Common sense” strategy
for protein purification
General principles and tips in “common sense” strategy
Common sense is the best guide in protein purification
For structural studies our goal is to purify protein to a reasonable purity
(90+%) with the best possible yield in the shortest possible time and with a minimum effort.
Taking all this into consideration common sense tells us that the best possible strategy
for protein purification would be one started with affinity or pseudo affinity chromatography. This
can give you purification fold of tens or even hundreds and results in almost pure protein even if
the level of TP expression is not high. An affinity matrix could be a matrix with cross-linked
substrate, pseudo substrate or inhibitor. The problem is that we need to create a special matrix and
to optimise conditions for chromatography for each protein individually; this may take a lot of
time.
The alternative is Tag Affinity Chromatography, which is now widely used. The
protein gets expressed with a tag genetically attached to it. The most common tags are His 6
(fished out on a Ni immobilised column) and GST (fished out on a Glutatione column). There are,
however, some restrictions to these methods. Firstly, it is not always possible to express tagged
protein in a properly folded, soluble form. Secondly, proteins with tags are useful for many
applications, but not for all. Often tags should be removed with the “specific” proteases and so
further purification steps are required and also complications may occur with the protease
presence.
In certain cases pseudo affinity chromatography could be considered as a first
chromatographic step in the purification protocol:
Heparin chromatography should be used for DNA-binding proteins,
Dye chromatography may be used for NAD/NADP binding proteins
For purification of the majority of enzymes and other soluble cytoplasmic proteins, we
propose “Common sense protocol” based on using 3 different types of chromatography
separating proteins by their
charge (ion exchange chromatography, IEC),
hydrophobicity (hydrophobic interaction chromatography, HIC) and
size (gel filtration, or size exclusive chromatography, SEC).
Common sense dictates the sequence of the steps:
1. IEC. It is logical to prepare cell free extract in low salt buffer pH 7-8 and apply it directly on
an ion exchange column. For acidic proteins and some basic proteins I propose to use anion
exchange chromatography on a DEAE-Sepharose FF column as a default first
purification step applying 10CBV of a 0-0.5M NaCl gradient in tris-HCl buffer pH 8.0
2. HIC. After IEC it is easy to prepare the sample for hydrophobic chromatography by addition
of ammonium sulphate. At this stage an ammonium sulphate cut could also be considered.
3. SEC. After hydrophobic chromatography, the protein can be concentrated by precipitation
with ammonium sulphate or by a milder method, using concentration by ultra filtration
(pressure unit or spin concentrators) and applied onto a gel filtration column typically
equilibrated in buffer 50mM tris-HCl pH 8.0, 0.5M NaCl. Gel filtration could also be
performed using a buffer suitable for the further use of TP (for example, 50mM phosphate
buffer pH 6.5, 50mM NaCl for NMR experiments) but low salt conditions should be
avoided.
As a rule, these 3 steps are enough to purify over expressed protein to purity of 90+% (this is
in cases where the level of target protein (TP) expression is higher than 10% of total cell
protein). If the level of TP expression is high (20+%) it may be that only 2 chromatography
steps are required to reach an acceptable level of purity (IEC – SEC, HIC- SEC or IEC-HIC).
27
In some cases, especially if the level of TP expression is low, a fourth step should be
considered which could be HPLC ion exchange chromatography as a first choice, alternatively,
low pressure IEC on a different type of matrix (at the same or different pH as that of the first
IEC), HPLC hydrophobic chromatography, chromatofocusing or possibly even more exotic
solutions can also be employed, but I never need to do it.
Hydrophobic chromatography is not so easy to adapt. Unfortunately unlike the
universal first purification step (IEC on DEAE-Sepharose column with uniform parameters)
HIC has to be optimized for every TP.
In the majority of cases a Phenyl-Toyopearl 650S column can be used successfully with
gradient of 10CV from 1.5-0M AS in tris-HCl buffer pH 8.0. Also Phenyl-HP cartridges are
useful if AKTA system is employed. However in some cases purification could benefit
significantly from using a more specific gradient or different type of matrix (strong Butyl-
Toyopearl or weak Ether-Toyopearl).
A serious problem is that for some proteins hydrophobic chromatography is not at all
suitable as they bind to a hydrophobic matrix irreversibly. During development of the
purification protocol I suggest to use about 20% of TP sample obtained after IEC to test HIC
compatibility in order to avoid losing the whole pool of the protein on a hydrophobic column.
In the case when HIC can not be applied second ion exchange chromatography could be
considered as a second or third (after SEC) purification step. This could be HPLC ion
exchange or low pressure IEC on a different type of matrix at the same or different pH as
that of the first IEC.
HPLC ion exchange chromatography was proved to be a powerful method and in some
cases may replace gel filtration or hydrophobic chromatography. Particularly I found it useful
for basic proteins. However, be aware that Resource and Mono matrixes used for HPLC IEC
seems to be rather aggressive with respect to non-specific irreversible protein binding. It varies
from protein to protein, so sometimes you can get your TP with excellent purity but very
disappointing yield.
About 60% of 360+ proteins on my list were successfully purified using above strategy.
Further 10% were DNA-binding proteins purified by Heparin chromatography and
20% were His-tagged proteins purified using Ni-NTA chromatography
About 5% of purifications failed due to protein instability or lack of soluble expression
In some cases, especially if level of TP expression is high it may only takes one day to
develop a proper "one day purification protocol”. Often, when optimisation of hydrophobic
chromatography is required by running and analysing the test HIC or if TP expression level is
low the development may take two or, in the most complicated cases, three days to finish.
Once developed and refined a three step purification protocol can be completed in one
working day (8 hours or so). As a rule there is no need to run SDS-PAGE after each step, you
can rely on previous purification to choose fractions with TP after each chromatography.
To achieve smooth quick purification you should have things prepared beforehand:
Stock solutions
Columns
Sonicator
Chromatography systems (it is convenient to have a separate system for gel
filtration). In case of unavailability of a second system, use spare peristaltic pump to
equilibrate gel filtration column while first and second purification steps are in
progress. The second system is not required if you use default buffer (such as 0.5M
NaCl, tris pH 8.0) for gel filtration.
Bradford reagent, spectrophotometer and cuvettes
SDS-PAGE equipment and solutions (or ready made gels) Apart from using the
optimal sequence of procedures to save time during protein purification there is a
number of Time saving tips (see Appendix2.3) Also always follow the
Golden rules (see Appendix2.4)
28
Algorithm for development of purification protocol for soluble over-
expressed protein
BLOCK I. Preparations
1. Prepare stock solutions, columns and chromatographic systems.
2. Perform a solubility test on the batch of cell paste that you are going to use and confirm
that TP was expressed as a soluble protein (see Solubility test protocol in Protocols section,
number 8). Estimate the level of expression.
If during this test you discover that the TP reversibly precipitates in low salt conditions you
may consider using this property at the first step or later in the purification procedure.
3. Using ExPasy database find information on the target protein (TP). Using ProtParam Tool
produce a primary structure analysis. Work out MW, amino acid composition, isoelectric
point (pI) and extinction coefficient of the protein.
4. If the protein has Cysteines, you may consider adding 1mM DTT to all buffers. However in
my practice I've found that it makes no difference on the redox state of the cysteins in the
protein whether buffers contain DTT or not.
5. Prepare cell free extract (CFE) (see Crude (cell free) extract preparation protocol in
Protocols section, number 2).
For acidic and neutral proteins (pI<8) use Buffer A (50mM tris-HCl pH 8.0).
For basic proteins (pI >8) use Buffer A’ (50mM MES-NaOH, pH 6.0)
For our scale the optimum amount of total protein in CFE is 75-500 mg (1-10g
of cell paste).
Save 0.1ml of the CFE for gel analysis
BLOCK II. Acidic and neutral proteins. Anion exchange chromatography
For self-made columns:
Wash 20-30 ml DEAE-Sepharose FF column with buffer A. Flow rate 4-5ml/min.
Apply CFE sample on the column. Collect flow through material.
Elute proteins with 300 ml of a linear gradient of NaCl from 0 to 0.5M in buffer A.
Collect 8 ml fractions.
For AKTA system:
o Depending on total protein in CFE use one (total protein <150mg) or two 5ml cartridges
DEAE FF.
o In program equilibrate column with 2CV of buffer A. Flow rate 5ml/min.
o Sample applied and column washed with 1CV of buffer A. Collect whole tubes.
o Gradient: 10CV 0 to 50%B (B=A+1M NaCl).
o Fractions: 2-2.5ml for 1 cartridge or 4ml for 2 cartridges.
6. A TP with pI below 6.5 most likely is bound to the column.
However, collect flow though fraction in the separate container or start to collect fractions, do
not discard it.
If TP has activity which can be easily assayed (time required for assay is shorter than
time required for SDS-PAGE analysis) go to step 7,
If assay is not possible go to step 8.
If TP has pI close to 7, then it’s probable that it does not bind to the DEAE-Sepharose
column. However, some proteins despite having a high calculated pI have acidic domains and
so they can be bound to the column.
If you are monitoring TP by activity, calculate total activity in the flow-through fraction
to be sure that all activity is there.
If an activity assay is not available, rely on protein concentration in flow-through
fraction. If it is lower than 30% of the protein concentration in CFE, it is likely that
protein stays on the column. To be on save side, run gel to find TP (step 9)
If TP does not bind to the column, go to step 11.
29
7. Analysis for activity. Analyse every third/fourth fraction for activity.
When a fraction with activity is found, assay each fraction around the active
fraction to find every fraction that is active.
Check protein concentration in those fractions using Bradford method and calculate
specific activity.
Combine 2-4 fractions with the highest specific activity, taking about 80-90% of all
activity. Only take fractions with higher specific activity than in CFE.
If specific activity of pure TP is known estimate its purity in the sample if it is
higher than 60% go to step 10, if it is lower go to step 11.
If specific activity of pure protein is unknown, go to step 11.
8. Analysis of protein concentration.
Analyse protein concentration in every second fraction. If expression of TP was
higher than 20%, you will probably find a very distinct protein peak, normally in 4-
6 fractions which most likely is a TP.
To find a TP for sure run SDS gel, step 9.
Nucleic
acids
Flow-through
fraction Typical
DEAE FF
chromatogram
9. SDS-PAGE analysis.
Only fractions containing protein should be analysed, including the flow through
fraction. It is not necessary to check each fraction, every second fraction is enough.
Prepare samples for a gel analysis as follows:
o Calculate and take volume of CFE containing 15-20g of CFE
o Suspend cell debris in the same volume of water as it was for CFE (the best
way to obtain fine suspension is to sonicate it briefly). Take the same volume
from suspension as for CFE
o Take the same volume from flow-through fraction
o From the fractions take equal volumes so that protein in each sample remains
between 2 and 25g. For example, the highest protein concentration in
fractions is 1mg/ml, so take 20-25l samples from fractions with protein
concentration 0.1 mg/ml. Normally in this step there are about 15-25
fractions containing any significant amount of protein, so a 15 well gel
normally suits the analysis.
o Add reducing agent and SDS sample buffer in the tubes and boil for 1 minute
in the preheated heating block. Apply samples on gel and run.
Once the gel run is completed, stain gel for 5 minutes with fresh stain and destain it
for about 10 minutes. Even better if you can use InstantBlue stain (Experion) or
similar stain, then you can see the bands in 5 minutes. Analyse gel to find fractions
with the TP.
Typical gel
analysis for
DEAE FF
chromatography
CP CFE 4 10 12 14 16 17 18 19 20 21 22 24 fractions
30
Combine 3-4 fractions with the highest content of the TP
Check volume and protein concentration and calculate total protein in the sample
If purity of the sample 60%, go to step 10, if it is lower go to step 11.
If TP is found in the flow through fraction, go to step 18
Sometimes protein has low affinity to DEAE FF. In this case you can see protein in
flow-through fraction and in the first fractions of wash and elution. In this case try
low affinity chromatography protocol (page 26).
10. Concentration.
Concentrate protein to 1-2 ml using a Viva Spin 20 concentrator with appropriate
MWCO. Go to step 17.
34
If there is no FPLC system, use low pressure equipment. Try anion exchange
chromatography on a DEAE-Toyopearl 650S column or a Q-Sepharose column in buffer
A. Also, you can change pH and run chromatography on either of the anion exchange
columns at a lower pH. 50mM MES-NaOH pH 6.5 can be considered. For basic proteins
increase pH to 7-7.5. Do not discard flow-through fraction as there is a high possibility
that protein will not bind to the column.
If protein is still not pure (and you haven’t actually lost all of it by this point!) further
options are FPLC HIC, chromatofocusing, preparative PAGE etc. In all my 25 year
practice there has not been a single protein which needed a fifth purification step.
2. TP has not been revealed after HIC. There are two ways to go:
The first way is to do a second ion-exchange chromatography, as described above
(DC 1).
The second way is to try a different type of HIC.
o Take 10-20% of the sample for the tests.
o The options are:
use an Ethyl-Toyopearl column instead of Phenyl-Toyopearl;
Use 2M KCl in buffer A as a loading and starting buffer on a Phenyl-
Toyopearl column or on a Butyl-Toyopearl column. The risk of losing the TP
on above columns is high, but if the protein is bound and eluted from them
successfully, there is a high chance of achieving a good purification.
3. TP precipitates with less than 1.5M AS or
basic TP precipitates with pH 5.5 or
TP does not bind to any column
This most likely means that TP is associated with small pieces of debris which are small
enough to stay in the supernatant fraction during CFE clarification. Only particles smaller
than 2MDa can enter the beads and be bound. If there is a significant insoluble component
of the TP revealed in the solubility test this is another sign that, despite the appearance of TP
as a soluble protein in the CFE, in reality the TP was expressed as an insoluble one. Try to
optimise growth condition during TP expression or try refolding from the inclusive bodies.
However there is small chance that the TP is one of rare proteins which reversibly precipitates
with 1.5M AS. In this case you should be able to dissolve it in 1-2ml of buffer A, clarify by
centrifugation and perform gel filtration.
F. Finish.
Congratulations, you have now got a purified protein.
Run a gel to analyse purification step by step.
Present on the gel should be:
MW markers, CFE, samples after each purification step and all pellets and supernatant
fractions which were obtained during purification. Take 15-20µg of total protein per
sample.
Analyse the gel pattern and work out the optimal purification protocol for the TP.
Prepare protein for use. I strongly recommend using freshly purified protein when and
where it is practical and possible.
For example: concentrate protein to 10mg/ml, change buffer to low salt 10mM tris –HCl
pH 8.0 or 50mM NaCl using diafiltration cup on VivaSpin or using desalting spin columns
(eg Zeba columns, Pierce) and use it for crystallisation on the same or next day.
35
Brief scheme of purification of soluble protein
Cell paste with over expressed TP
Suspend in appropriate buffer ↓ 50 mM buffer pH 8.0
Disruption (sonication or French-Press) ↓
Spin down debris ↓ Centrifugation 45000-70000 g, 10-15 min.
Crude extract
Ion exchange chromatography
anion exchange for acidic protein (column with DEAE-Sepharose or Q-Sepharose)
cation exchange for basic proteins (column CM-Sepharose or SP- Sepharose)
analysis of elution profile (Bradford, activity, SDS-PAGE), pooling of fractions containing TP
Ammonium sulphate precipitation analytical trial
Concentration on VivaSpin concentrators or
Ammonium sulphate precipitation for storage or
to prepare a sample for gel filtration 0.5-1hour
The whole procedure takes from 4 hours (for two step procedure)
to 8-10 hours (for a 3 step procedure with SDS-PAGE after first step)
37
Purification of DNA-binding proteins
For some DNA binding proteins it was found very effective to use big difference in solubility at
different salt concentration.
Cells can be destroyed in Buffer A and after centrifugation TP is found in the pellet.
Then it can be extracted using 1M NaCl.
Next step could be AS cut
Further purification is performed by gel filtration or Heparin chromatography.
38
Protocol 1
CFE prepared in buffer A+0.1M NaCl
Heparin chromatography
Ammonium sulphate cut
Gel filtration or IEC
Protocol 2
Disruption by sonication in buffer 50 mM tris-HCl pH 8.0,
4mM MgCl2, (1mM DTT), 5µg/ ml Dnase I or bensonase
P-Cellufine Chromatography
Final preparation
39
Protein purification statistics
40
IV. Protocols
1. Protocol for preparation of the stock solution
Salts stocks preparation
1. Take a 1 litre glass beaker with a big magnetic follower bar and pour in the weight of
salt powder that is required.
To prepare 1litre of 1M solution of any substance take amount in grams equal to its
MW.
For 5M NaCl weight 292g. For 4M Ammonium sulphate weight 528g.
2. Pour ultra pure water into the beaker to approximately the 900-950ml mark.
3. Place on a stirrer and switch on. At the start you should help the magnet to start rotating by
stirring the slurry with a rod or a spatula.
4. When the salt has dissolved pour the solution into a 1 litre volumetric flask.
To make sure all the salt has been washed into the flask, rinse the beaker with 2-3 small
volumes of ultra pure water and add them to the flask.
Make the volume up to the 1 litre mark with additional ultra pure water.
You may have a problem with dissolving all the ammonium sulphate because 4M is close to
the saturation point. To encourage dissolving, you can gently heat the mixture up to 40-
50oC under constant control (to prevent overheating). Alternatively you can wait until most
of the salt is dissolved, switch the stirrer off and gently pour the clear solution in to the
volumetric flask. Add a little bit of ultra pure water to the rest of the salt in the beaker, stir
it briefly and add any clear solution to the volumetric flask. Do this 2-3 times until all the
salt has dissolved. Be careful not to exceed 1 litre!!!
4. Filtrate solution through a 0.22mfilter using Filter Holder with Cellulose Nitrate Whatman
filter or Stericup Filter Unit connected to a vacuum pump. Always wet the membrane with
a few drops of ultra pure water before you start filtration.
Using the vacuum pump wash Filter Holder’s porous disk with plenty of grey tap water
immediately after use to prevent salt crystallising in the pores and therefore blocking the
filter.
5. Pour solution into a clean bottle. Write the date and your initials on it.
6. For a control measure, check the refraction of the solution. For 4M (NH4)2SO4, it should be
37% and for 5M NaCl it should be 28% on a sugar refractometer.
41
2. Protocol for quick and effective cell disruption
and preparation of the crude extract (cell free extract)
1. Cell harvesting
Spin down cells first in the big bottles
Re-suspend pellets in about 50 ml of culture medium, place in a 50 ml Falcon tube and
spin down for 10-15 min at 5000 rpm.
Remove medium and put tube with cell pellet in to the -20C or -70C freezer.
Alternatively suspend cells in Lysis buffer (see p16) (5-10 ml per gram of cell paste), pour
into a Falcon tube and put it in to the freezer.
Remember to use Virkon for decontamination of discarded medium
2. On the day of protein purification:
take cell paste from the freezer, add 8-15 ml of lysis buffer (e.g. Buffer A) per gram (ml)
of cell paste
let it thaw for 5 minutes, briefly suspend cell paste with spatula
divide suspension into 10-15 ml portions placing them into 20 ml plastic vials using a
plastic pipette . If there is small amount of cell paste (1g or less) you may use small 5 ml
containers to place 3-4 ml of cell suspension in each.
Place vials on an ice bath.
Tip: for more effective cooling put small pieces of ice into the vials.
If cells were frozen with buffer, for quick defrosting place tube in to warm water or hold under
a hot water tap, mixing by tipping upside down until it thaws. Then divide into portions as
above.
3. Before you start sonication, put rotor (JA-20 or JA-25.50) into the Avanti centrifuge, close
the lid and set pre-cooling at 4C
4. Mount medium probe on a Soniprep 150 machine. Tighten it properly with the tool, but do
not over-force.
Lower probe into the vial with the sample, leaving 2mm between the probe and the
bottom of the vial; the probe should not touch the bottom of the vial but neither should it
be close to the surface of the sample. If the probe is too close to the surface, foam will
form, this should be prevented to avoid oxidation and denaturing of proteins.
5. Set sonicator for maximum force. This corresponds to 16 micron amplitude.
6. Sonicate portions one after another for 20 seconds each. Carry out 2-4 cycles without a
break. The samples will cool down while you treat other portions. If you use small (5ml)
containers, treatment should last for 8 seconds. If you have got just two portions to treat,
be more careful and put ice pieces into containers between the sonication cycles.
If power does not reach 16 micron, try reattaching the probe (tighten it more).
7. After completion of sonication unscrew the probe, wash it with distilled water and dry with
tissue. Place back in the box.
8. Pour homogenate in to the centrifugation tubes, balance them and spin down in JA-20 or
JA-25.50 rotor at 4C
for JA-20 rotor in J-20 centrifuge set 19000 rpm
(about 43000g) for 15 minutes
for JA-25.5 rotor in J-25 Avanti centrifuge set 24000 rpm
(about 70000g) for 10 min
9. Once centrifugation has finished pour supernatant fraction into the cylinder (if you use
peristaltic pump for chromatography) or in the beaker (for AKTA system application) and
keep it cold. Check volume. Check protein concentration (see protocol for Bradford assay in
Appendix). Calculate total protein.
The Crude extract (Cell Free Extract) is now ready for the next step.
42
3. Protocol for protamin sulphate (PS) treatment
1. Measure volume of the crude extract
2. Calculate an amount of protamin sulphate taking 2mg for each ml of the crude extract, weigh
this amount into an eppendorf tube and suspend it in 1 ml of water. It takes a long time for
protamin sulphate to dissolve, so do not wait and use the suspension instead.
3. Place a beaker with the crude extract into an ice bath or in the cold cabinet or cold room at
4ºC on a stirrer and set one to an appropriate speed (the vortex should appear in the middle
of the beaker).
4. Add protamin sulphate suspension drop by drop. Stir for about 10 minutes.
5. Spin down precipitate at 40000g for 15 minutes or at 70000g for 10 minutes.
6. Recover supernatant fraction, check volume and protein concentration.
Remember that some proteins can not be recovered from ammonium sulphate
precipitate
44
8. Analysis of solubility of expression
A. “Bug buster” method
Preparation of the solutions:
Reagent A: BugBuster Protein extraction Reagent from Novagen
Reagent B: Benzonase Nuclease (product 70746 from Novagen), 25u/μl, 0.2ml.
Divide this 0.2ml sample in to 20x10μl portions in 0.5ml eppendorf tubes. Store at -
20˚C (not -70˚C).
Prepare 4ml of the buffer 50mM tris-HCl pH 8.0, 20mM NaCl, 5mM MgCl2, 20%
glycerol and make 20x190μl aliquots in 0.5ml tubes, keep them frozen at -20˚C.
Prepare working solution: Take buffer from the one tube and add it into the tube
with 10μl of benzonase making 20 fold dilution). Make 50x4μl aliquots in 0.5ml
tubes and store them at -20˚C. Mark these tubes "reagent B".
Method:
1. Take one tube of reagent B from the freezer and add 0.1 ml of reagent A (stored at room
temp.)
2. Prepare about 20 μl of cell paste pellet in a 1.5ml tube. To get this, spin down 1-1.5 ml of
culture or take a bit of frozen cell paste.
3. Add 0.1 ml of reagent A+B to the cell paste. Suspend it properly using a small plastic rod.
Do not pipet up and down to avoid bubbles.
4. Place on a rotating platform and incubate for 10 min.
5. Spin down debris at 20000g for 5-10 min in the refrigerated centrifuge.
6. Take out supernatant and place into another tube. Mark it ‘S’
7. Add 0.1 ml of 2% SDS solution to the tube with pellet and suspend it properly with a rod.
Mark it ‘P’.
B. Sonication method
1. Suspend 30-50 µl of cell paste in 0.3-0.5ml of Buffer A in 1.5 ml eppendorf. Place on ice.
2. Using thin probe apply sonication at 16 micron amplitude for 2-3 sec. It is most convenient
to hold tube in hand to control temperature to avoid overheating. Place tube on ice for 20sec
to cool down.
3. Repeat sonication 3-4 times.
4. Spin down debris in the refrigerated centrifuge at 4oC, for 10 min, at 20000g.
5. Separate supernatant fraction into another tube (mark it ‘S’).
6. Re-suspend pellet in equal volume of water or buffer or 2% SDS (mark tube with ‘P’).
For DNA-binding proteins for sonication take buffer:
1M NaCl, 50 mM tris-HCl pH 8.0 or use Alternative way:
Re-suspend debris pellet in 0.1 ml of 50 mM tris pH 8.0, 1M NaCl,
Spin down pellet as above.
Separate supernatant fraction in to a clean tube. Mark tube S1.
Re-suspend pellet in water or SDS as above (tube P).
SDS-PAGE analysis
1. Check protein concentration in supernatant fraction (tube S) and in tube S1 (if applicable)
2. To prepare a “Soluble proteins” sample take about 20 g of total protein from tube S for
a sample for gel, add water to make total volume 15µl if necessary. Take approx 10g of
protein from tube S1 if there is any noticeable protein concentration.
3. To prepare “Insoluble proteins” sample take the same volume from the tube P as you took
from tube S for a sample for gel, add extra SDS (10% solution) so as to make the SDS
concentration about 4%.
4. Preheat dry block to 100oC or make bath with the boiling water.
5. Add 4x-Sample Buffer and 10x-Reducing agent (both from Invirogen) to the samples and
boil them for 2 min. Apply on a gel. To make your gel more informative place pre-induction
cells sample prepared the same way as over-expressed cells sample.
45
9. Analysis of expression for low expressed His tagged protein
46
10. Bio-Rad protein assay protocol
Bradford Method
(Sveta’s adaptation of the Bio-Rad micro assay procedure)
1. Into a plastic cuvette (1.6 ml volume) place 1-20 µl of protein solution, containing
approximately 1-10 µg of protein
2. Add 0.8 ml of ultra pure water and 0.2 ml of Bio-Rad Dye Reagent Concentrate
3. Seal cuvette with parafilm and mix carefully by tipping upside down and right way up
again.
4. Measure OD 595 . It should be between 0.1 and 0.7.
If readings are higher, dilute protein solution or take smaller volume, if they are lower,
increase volume of protein solution taken for test and decrease the volume of water
accordingly to keep total volume of test within 1 ml.
5. Calculate Protein concentration using formula:
OD 595 x 15
--------------------------- = protein concentration (mg/ml)
volume of protein (µl)
Usually while monitoring protein concentration during purification we do not need high
accuracy, but still be careful in aliquot handling and pipetting especially when you take
small aliquots. I would not recommend you to take less than a 1μl sample. When taking
1μl, always check amount of liquid in the tip and remove any liquid attached to the outside
surface of the tip. After pipetting sample out make sure that the tip is empty. Do two
repetitions and if difference between them is more then 10%, repeat it again!
47
12. Calibration plot for gel filtration column
1. Find suitable proteins to cover MW from 500kDa to 5kDa. Apart of proteins listed in the
LMW and HMW kits (GE Healthcare) the following proteins may be suggested:
Glutamate Dehydrogenase (330kDa), Catalase (250kda), , Amylase (200kDa), Alcohol
Dehydrogenase (150kDa), Bovine albumin (66kDa), Trypsin inhibitor (20.1kDa),
Cytochome C (12.3kDa), insulin (5.8kDa).
2. Chose set of 4 proteins with MW differs from each other 2-3 fold. Say, Catalase, Bovine
albumin, Trypsin inhibitor, insulin. Or GluDH, AlhDH, Ovalbumin, Cytochome C and so
on.
3. Balance about 10mg of each protein in to 1.5ml tubes and dissolve in 1ml of buffer
50mM tris pH 8.0, 0.1M NaCl.
4. Take optical density at 280nm for each protein. In order to do it make 0.8ml of 10 fold
dilutions (0.72ml buffer+0.08ml protein solution) and take measurements in the 1ml
quartz cuvette. Alternatively use NanoDrop or Nanophotometer.
5. Calculate volume of each protein corresponding to 1optical unit, take corresponding
volume of each protein and mix it in the new tube. For example: 280nm density was: for
protein 1- 6ou/ml, for protein 2 - 8ou/ml, for protein 3 - 10ou/ml, for protein 4 - 4.5ou/ml.
To make a mix take 0.167ml of protein 1, 0.125ml of protein 2, 0.1ml of protein 3,
0.22ml protein 4.
6. Make volume of the mix to 1-2ml and apply on a column (1.6x60cm HiLoad Superdex).
Run gel filtration at the same flow rate and in the same buffer as for an experimental
protein. For smaller or bigger columns adjust amount of proteins accordingly
( 0.25ou/protein for 1x30cm Superdex columns or 2.5ou/protein for 2.6x60cm columns)
7. Carefully measure elution volume (Ve) of each peak. If you use a peristaltic pump and a
pen-paper recorder it is important to measure the actual flow rate carefully in order to get
accurate Ve values.
8. To make calibration plot you also have to know void volume Vo and total column
volume Vt. For total volume take height of the column bed in cm, multiply by cross area
of the column) For 1.6x60 Hi-LoadSuperdex200 column normally total column volume
equals 120ml. To find Vo run separate run of Blue dextran. Apply 2-3 optical units at
280nm and take elution volume of the first peak as a Vo. For 1.6x60 Hi-LoadSuperdex200
this value typically is around 45ml. This value is rather stable; do not check it each time
unless the column size was changed (as a result of a drying event or cleaning of the top of
the column).
9. For full and more accurate calibration run 2 sets of different proteins.
10. Make plot KAV=(Ve-Vo)/(Vt-Vo) versus logMW. The another way to plot results may be
logMW versus Ve/Vo. Both give you a linear plot, but latter version is not used nowadays.
49
15. DTNB reaction
Reagents:
bufferN: 0.1M Na phosphate , 1mM EDTA pH 7.3
bufferG: 6M GuHCl, 0.1M Na Phosphate, 1mM EDTA pH 7.3
DTNB reagent: 10mM in bufferN
Reaction:
1. Take 0.9ml of bufferN or bufferG in cuvette and add 0.1ml of DTNB reagent. Mix and
use the cuvette to blank spectrophotometer at 412nm.
2. To the cuvette add 10-50ul of the protein solution (0.5-1mM), mix, incubate for 1-2
minutes and take measurement at 412nm.
3. Calculations:
A412/0.0136 = concentration of TNB in µM
(concentration of TNB in µM) / (concentration of protein in µM)= SH groups/protein molecule
Make 2-3 protein concentrations
50
V. Charts and Tables
51
52
53
54
Calibration plot
Calibration plot forfor Superdex200
Hi-Load Superdex200
0.5M NaCl, 50mM tris-HCl pH 8.0
0.9
0.8
0.7
0.6
0.5
Kav
0.4
0.3
0.2
0.1
0
3.5 4 4.5 5 5.5 6
logMW
Kav=(Ve-Vo)/(Vt-Vo)=(Ve-45)/75
(for HiLoad 1.6x60cm column)
55
Calibration plot at various salt concentrations
Superdex 200 GL column
2.5
2.4
2.3
2.2
2.1
1.9
Ve/Vo
1.8
1.7
1.6
1.5
1.4
1.3
1.2
1.1
3.6 3.8 4 4.2 4.4 4.6 4.8 5 5.2 5.4 5.6 5.8
lgMW
56
57
Properties of amino acid residues
58
VI. Appendix 1
1. Determination of the protein concentration
There are two widely used ways to determine protein concentration.
Firstly there are a number of colorimetric methods based on the formation of reagent-
protein coloured complexes. Most acknowledged are the Biuret method, Lowry method
and Bradford method. The latter method is most simple and so most suitable for protein
monitoring during purification.
The second way is based on UV absorbance of the aromatic residues. Absorbance at
280nm is widely used. Also one can use absorbance at λmax which can be revealed by
taking a spectrum of the protein between 240nm and 340nm.
Bradford Method
This method is based on formation of Protein – Coomassie Brilliant Blue G-250 complex which
has maximum absorbance at 595 nm.
Advantages: Rapid, Simple,
Sensitive (small amount of protein required for test),
Highly compatible with most reagents and substances
Disadvantage: Significant protein to protein variations
Applications: Monitoring of protein concentration during purification
Determination of relative concentration of pure proteins
See Protocol section for Bio-Rad protein assay protocol, the adaptation of Bio-Rad micro
assay procedure, based on the Bradford method. Also read instruction enclosed with Bio-Rad
reagent.
In the protocol mentioned above incubation with reagent (normally 5 min) is skipped to save
more time during protein purification. The reason to do so is that about 90% of the coloured
complex is formed within one minute while you mix the reagents. This is applicable to the
majority of proteins, but some of them (1-2% from my experience) need more time to develop the
full colouring. The most extreme case was one of the Fab fragments which required 1 hour
incubation. Be aware of that when you start to work with the new TP.
Protein can be denatured to increase its reaction with the reagent.
59
Calculated extinction coefficient is given for fully unfolded protein in the presence of 6M Gu-
HCl. The reason for this is that hydrophobic surrounding of aromatic residues involved in core
of the folded protein leads to increasing of their extinction coefficient.
60
UV spectrum of the
tryptophan-free protein
The observed absorbance
corresponds mainly
to the tyrosine residues
UV spectrum of the
tryptophan containing
protein
The observed absorbance
corresponds to a
combination of the
tryptophan and the tyrosine
residues in the protein
61
See example below for further explanation:
Spectra shown belong to FtsZ protein from Bacillus subtilis.
This protein has 2 tyrosines and 9 phenylalanines out of total 382 residues. This is why for this
protein the value of Abs 0.1% (1mg/ml) at 280nm is as low as 0.063.
The shape of the spectrum is unusual because of the visible contribution from the phenylalanine
absorbance which is normally hardly detectable. Also contribution from peptide bond
absorbance at 230nm makes significant contribution to the shape of the spectrum almost
eliminating the minimum at 250nm. As you can see without the deductions of underlined
absorbance in Spectrum 1, for protein in 10mM tris-HCl pH 8.0 error is just 8%, well within
acceptable for most of uses 10% level. For Spectrum 2 the error is high 21%. And if you
calculate protein concentration from A280 in Spectrum 3, you overestimate it at least 100%.
Spectrum 1.
This spectrum is taken from FtsZ in buffer
10mM tris-HCl pH 8.0
Light scattering is very low, however there is
some absorbance at 305nm which should be
deducted from absorbance at 280nm.
Abs280-Abs305=0.787-0.066=0.721
Conc=0.721/0.063=11.4mg/ml
Spectrum 2.
This is spectrum of FtsZ in buffer 50mM MES
pH 6.5, 0.2M NaCl.
This spectrum is still suitable for calculations,
light scattering is not too high, but base line
obviously is not zeroed properly. So once again
absorbance at 305nm should be deducted from
absorbance at 280nm
Abs280-Abs305=0.469-0.097=0.372
Conc=0.372/0.063=5.9mg/ml
Spectrum 3
Spectrum of FtsZ in buffer 10mM MES, 2mM
MgAc, 1mM EDTA
Significant light scattering on aggregates not only
affects value of absorbance at 280nm but also a
shape of the spectrum. This spectrum is
unsuitable for calculations
62
2. How to concentrate proteins
Concentration by precipitation
Precipitants which are used for proteins:
Salts:
Ammonium Sulphate is mainly used for protein precipitation
Alcohols:
Ethanol, isopropanol, MPD
Polyols:
PEG of low MW (about 1000 Da)
Acetone
Acids:
Trichloracetic acid (TCA)
Using any kind of precipitation normally leads to at least 20% loss of the material (often
more).
Precipitation by acetone
Precipitation by acetone could be useful if you need to prepare samples of protein under
denaturing conditions (for example, for gel analysis). Very few proteins could be
recovered from acetone precipitate natively.
To the protein sample add 10 volumes of cold (from the freezer) acetone. Spin down at 0-
4ºC for 20 min at 5000g or higher speed. Remove acetone from the tube and evaporate out
the rest of it under an air stream. Dissolve pellets in small volume of SDS, urea or Gu-HCl
solutions.
This method could not be applied for samples with high salt concentration because salt is
precipitated with the acetone as well.
63
Precipitation by acids
To precipitate proteins by TCA, add 50% solution into protein sample to make an acid
concentration of about 10%. Collect pellets by centrifugation. To dissolve precipitate, use
a basic solution of denaturing agents. This method is applied for preparation of denatured
samples and has no restrictions from the high salt concentration.
Mild acidic precipitation could be achieved by dialysing protein solution against Na
acetate pH 5.0. Proteins with pI close to 5 precipitate and could be collected by
centrifugation and dissolved in appropriate buffer of pH 7-8. As usual the method is
suitable for some proteins but not all of them. It is not rare for proteins to denature when
precipitated under acidic conditions.
All the above methods except the ammonium sulphate precipitation are rarely used
today.
Concentration by chromatography
This method is not one in frequent use, but sometimes you may want to use it.
It is most useful for concentration of very diluted protein, especially if the sample has a
high ammonium sulphate concentration.
Make a small column of appropriate hydrophobic resin (Phenyl-Toyopeal, as a rule). Take
1 ml of resin for 20mg of protein. Wash it with ammonium sulphate solution of
appropriate concentration (2.5M is fine for most proteins). Make sure that ammonium
sulphate concentration in the sample is high enough to allow protein to bind to column
(2.5M-3M of ammonium sulphate). Apply sample on a column. To collect concentrated
protein wash column with appropriate buffer (i.e. 50mM tris-HCl, pH 8.0). Collect 10
fractions equal to 1/3 – 1/2 volume of the column. Check protein concentration in the
fractions and combine fractions with the desirable level of protein concentration. Yield of
recovery could be between 50 and 80%.
A similar procedure can be applied for concentration of a dilute protein sample in low salt
buffer solutions. Choose appropriate ion-exchange resin. Elute protein with 1M NaCl in
appropriate buffer.
His-tagged protein could be concentrated this way too, but because affinity of His-tag to
Ni column vary from one protein to another, for many proteins it is not possible to obtain a
high concentration. For some proteins it is not possible to reach a concentration higher
than 3-4 mg/ml using this method.
Concentration by evaporation
Volume of solution can be reduced (so protein concentration can be increased) by
evaporation of water. Water can be evaporated by a few techniques. To reduce volume of
the small samples (less than 0.2 ml) the simplest way is to use stream of air or better inert
gas (nitrogen, argon, etc). Place the protein solution into the eppendorf tube and mount it
on the stand. Connect tubing with thin opening (such as a gilson tip) to the air or gas tap
64
and mount it above the eppendorf tube. Make stream go through tubing, open tap slowly,
to make the solution in the tube move slightly. Check volume in the tube every 5-10 min.
It takes about 30-40 minutes to reduce volume by 0.1 ml or so. Remember that the salt
concentration increases too so you may need to perform dialysis against required buffer
afterwards.
Another way to reduce volume by evaporation is to use a vacuum to let water evaporate
quickly. Normally such evaporation is performed in a vacuum centrifuge called SpeedVac.
Depending on vacuum, it takes a few hours to evaporate about 1ml of water.
Another way to use evaporation is to dry the protein solution completely. For some
proteins (most stable ones) it is a good way of storage. It may be appropriate for some
proteins to be desalted by dialysis or gel filtration prior to drying. Alternatively, protein
can be dried in the presence of buffer. Drying (also known as lyophilisation) is performed
in the machine called a vacuum-freeze dryer. Place protein solution into the round, pear-
shaped or conical bottom flask. Volume of solution should be about 20% of the flask’s
volume. Solution should be distributed on the inner surface of the flask and frozen by
rotating flask in the bath with dry ice or liquid nitrogen. The frozen flask should be
immediately mounted on the working dryer.
Small volumes of protein (0.5-1ml) can also be dried on the machine. Put solution into an
eppendorf tube, close the lid, make a few holes in the lid, freeze sample in the liquid
nitrogen, place it in to the flask and mount flask to the dryer.
65
3. How to store proteins
The safest way to use proteins is to use them fresh, in a few hours or days after
purification. Nevertheless the majority of proteins can be successfully stored using three
main methods:
Frozen at -20oC or better -70oC
Precipitated with ammonium sulphate at 4oC or even room temperature
Vacuum dried
Freezing
Protein solutions could be frozen and kept at freezing temperatures for a very long time.
The best way to freeze protein is to place it in liquid nitrogen. But for many proteins it is
OK just to put them in the freezer.
For concentrated protein solutions (more than 10mg/ml) it is not necessary to add anti-
freezing agent such as glycerol, but for dilute solutions it is better to add glycerol to a 10-
40% concentration.
Precipitation
Vacuum drying
66
4. How to estimate purity of a protein preparation
67
68
VII. Appendix 2
1. Prepare your solutions right!
69
2. Gel Filtration
Separation by molecule’s size
Elution
Narrow zone
of applied
sample
concentration
V0 Ve Ve Vl
volume
The calibration plot however is usually presented as a Kav versus LogMW. This way the
calibration plot became independent of the column parameters.
70
Kav is proportion of inner beads volume available for the particular protein.
Vo – void volume
Ve – elution volume
Vt – total column volume
Obtaining a calibration plot
71
Here is presented the calibration plot
obtained for the gel filtration media
Superdex 200.
72
3. Time-saving tips
in protein purification
Make proper stock solution which will last for a long time so you can prepare
any buffer solution for your purification in seconds
When preparing cell free extract by sonication divide cell suspension between
2-4 portions and put pieces of ice into them so you can save time on the
cooling
To remove cell debris apply only 10-15 min centrifugation, the longer spins
is not practical because there is no need to remove small particles as they pass
the column safely causing no harm
After you apply sample on the column do not wash out unbound material
with the starting buffer. The only exception is if the target protein (TP) is
going to be eluted from the column very close to the start of the salt gradient.
With the beginning of the salt gradient the unbound material is removed from
the column much more effectively than with the starting buffer
If expression level of TP is higher than 10%, in most cases the highest protein
peak on the chromatogram is TP. So you can find it by checking protein
concentrations in fractions by the fast Bradford method and save time on gel
analysis
If you need to analyse fractions by gel and you have not got pre-cast gels,
then start to prepare gel immediately after you have started the
chromatography
Do not wait until all gradient is applied on a column. It is useful to start to
analyse protein concentration and activity (if applied) in the fractions after
about one third of the gradient have been applied on a column. This is
normally the position of TP elution if gradient was properly optimised
If you use a gel to find TP after first chromatography, to reveal result
quickly stain gel for 5-10 min with fresh stain and distain it briefly for a few
minutes so as to reveal just the major bands. As a rule, TP can be identified
successfully this way. Combine appropriate fractions and move on for the
next purification step leaving gel to be properly stained-distained later.
73
4. Golden Rules
in protein purification
DO NOT DISCARD ANYTHING (pellets, supernatant fractions or
fractions obtained during any chromatography) until purification is
complete and analysed by SDS-PAGE.
Always collect flow through column fraction.
Have a basic set of columns pre-packed and keep them in good order.
Always wash ion-exchange columns with 2M NaCl and hydrophobic
columns with water after use
Keep your pipettors in good order, never allow liquid inside the pipettor.
It is best to have your own set, clean them trough once a year and check
their calibration
74
VIII. Show cases
1. BPSL 1549 (BLF1)
Two step purification and a lesson to learn
BPSL 1549 (Burkholderia Lethal Factor 1) was the most interesting project done in our
crystallographic group so far. Apart of its biological role (Science 334, 821-824, 2011) it also
shows some unusual features as a protein.
ProtParam results revealed just one unusual feature:
MW 23342Da
pI 5.14
Abs 0.1% (1mg/ml)= 2.4 It is very high and rather unusual.
BPSL 1549, back then being referred as a putative protein of unknown function, was highly
expressed in TUNER cells, where chloramphenicol-acyl-transpherase (CAT) (23kDa) normally
also being expressed to a significant level.
Because of that analysing level and solubility of expression (see gel picture below) we could
not be sure was there the target protein expressed or was it CAT.
1 2 3
1. Mark12 MW standard
2. Cell debris
3. Cell free extract CFE)
31kDa →
20kDa →
The standard approach for an acidic protein was applied for the purification.
Cell free extract was prepared in Buffer A and applied on a 25ml DEAE-Sepharose FF column.
300ml gradient from 0 to 0.5M NaCl was applied for elution. 7.5ml fractions were collected.
Because of the very high level of expression I have relayed on a protein concentration estimated
by method of Bradford to find the elution position of the target protein (see the chart below)
0.9 2.5
A 595 [NaCl], M
0.8
0.7 2
0.6
1.5
0.5
0.4
1
0.3
0.2 0.5
0.1
0 0
0 5 10 15 20 25 30 35 40
Fractions
75
The main protein peak was found eluted with about 0.24M NaCl . It was position where CAT
elutes from the column, but it also did not contradict with the target protein pI 5.14.
Two fractions with the highest protein concentration were combined, concentrated using Viva
Spin concentrator and applied on a gel filtration column, Hi Load Superdex200.
Peak was eluted at 75ml, suggesting MW about 70kDa, the position where CAT elutes from the
Superdex200 column.
To confirm that it was CAT, the sample was supplied with 1.5M ammonium sulphate and
applied on 8ml Phenyl Toyopearl 650S column. Elution was performed by the 80ml reverse
gradient of ammonium sulphate concentration from 1.5M to 0 in Buffer A. 4ml fractions were
collected and analysed by method of Bradford. Protein peak was found at a very end of the
gradient, where CAT elutes from the Phenyl Toyopearl column.
It looked like that target protein was not expressed, but if so, the one thing was odd – the level
of expression of the 23kDa protein was much higher than the normal level of CAT expression
under the same standard growth conditions.
At that point SDS PAGE analysis was employed (NuPage 4-12% BT Novex gel, see picture
below) and revealed massive protein peak in the beginning of the gradient, at about 80mM NaCl
(fr. 5-11) .
BPSL1549 CAT
Fractions 7 and 8 were combined, concentrated to 2ml and applied on a Superdex200 column.
Peak was eluted at 90ml, which suggested a monomeric state of the BPSL1549 in solution.
So, BPSL1549 does not react with the Bradford reagent properly. It does react with Coomassi
only when denatured by SDS and exhibits a good bands in the gel, but it does show very low
reaction with Coomassi under normal assay conditions (see Bradford calibration plot for
BPSL1549 below).
0.8
A 595
0.6
BPSL1549
0.4 BSA
Linear (BSA)
0.2
0
0 10 20 30 40 50 60 70 80
protein, microgram
76
It was a good lesson which showed me that 20 years experience is not 100% relevant and one
day the convinient short cut may fail dramatically. Since then when I develop the purification
protocol for a new protein I run the SDS PAGE to analyse an elution profile on a first
chromatographic step.
Apart of the trouble with the Bradford’s method, this purification is a good example of two step
purification protocol. High level of expression and early elution from DEAE-Sepharose makes
it possible to obtain 95%+ purity by combination of AEC and SEC. See below the refined
purification procedure with the use of AKTA system.
About 1g of the cell paste was defrosted, suspended in about 27ml of buffer A and disrupted by
sonication. Debris was removed by centrifugation (10 min at 70000g). CFE was obtained in
27ml, protein concentration by Bradford =2.7mg/ml, total 73mg (total protein here mainly
corresponds to [Link] proteins).
CFE was applied on a 5ml Hi-Trap DEAE FF cartridge. 40ml (8CV) of the gradient 0 to 0.3M
NaCl was applied for elution. Elution was performed at flow rate 4ml/min, 3ml fractions were
collected (see chromatogram below).
8mS/cm
~0.08MNaCl
Sample was concentrated to 2ml using Viva Spin concentrator and applied on a 16x60 Hi-
Load Superdex200 column. Gel filtration was performed at flow rate 1.5ml/min in Buffer
A suplimented with 0.5M NaCl (“standard GF buffer”).
77
Peak of A280 was observed in fractions 7 to 11.
Fractions 8-10 were combined, volume 6ml, concentartion 2.6mg/ml (by A280),
total yield 15mg.
1. Mark 12
2. CFE
3. DEAE fr 11-13
78
2. It is easy with coloured proteins!
Cgb was expressed in [Link] BL 21 strain and though the overall level of expression was
relatively high it was mainly insoluble. Only 10-15% of the expressed Cgb was presented in the
cell free extract, so that Cgb represented not more then 1-2% of total protein in the CFE.
Generally speaking it is unlikely to succeed with 3step purification protocol with so low
expression level of the target protein, but lucky combination of the properties of Cgb made it
possible.
Firstly, the protein has pI 6.14 and so it have relatively low affinity to anion exchanger. pH for
the first (DEAE-Sepharose) chromatography had to be increased to 9 and salt concentration had
to low down to 3mS/cm in conductivity terms in order to bind Cgb to the column. So it was
eluted from the column at very beginning of NaCl gradient, where not too many [Link] proteins
appeared.
Secondly, Cgb was found to be relatively hydrophilic protein so powerful HIC was applicable.
Thirdly, Cgb is a monomer of 16kDa and so gel filtration worked well to separate main
contaminations remained after HIC.
Below is presented optimized and refined procedure for Cgb purification.
Cell free extract (CFE) was prepared in bufferA(50mM tris buffer pH 9.0) using cells from 2l
culture (about 7g). Cells were disrupted by sonication (3x20sec at 16micron amplitude) and cell
debris was removed by 10 min centrifugation at 72000g.
CFE: V=34ml, C=16mg/ml, total protein 540mg. Conductivity was checked in CFE and it was
diluted with water to 3mS/cm (total volume of the sample became 50ml).
CFE was applied on a 25ml DEAE-Sepharose column at flow rate 5ml/min on AKTA purifier
system. 5ml fractions were collected. Elution was performed with 250ml of NaCl concentration
gradient from 0 to 0.3M in 50mM tris-HCl pH 9.0 (see chromatogram below).
79
Sample was supplemented with 9ml of 4M ammonium sulphate (to 1.25M) and applied on a
5ml HiTrap-Phenyl-HP column at flow rate 4ml/min. Elution was done by reverse concentration
of ammonium sulphate from 1.2M to 0 in bufferA. 2.5ml fractions were collected.
Red fractions 13-15 were combined: V=7.5ml, C=0.6mg/ml, 4.5mg. Red fraction 16 had not
been taken on grounds of having high A280 and so being more contaminated than other fractions.
Volume was reduced to 2ml using VivaSpin device with MWCO 5000 and sample was applied
on a 1.6x60cmHiLoad Superdex200 column. Gel filtration was performed at flow rate
1.5ml/min and 2ml fractions were collected:
80
Flavohemoprotein HMP from Escherichia coli
MW 43837Da
pI 5.5
A280 1mg/ml 1.16
HMP contains two chromophores, Flavin and Hem, so colour of the protein has a bit of orange
shade, which does not make a significant contribution to the shape of a visible spectrum of the
protein any way.
Level of expression of HMP typically is low, hardly exceed 3%, so we would not expect to
purify it to 90%+ purity in 3 step procedure, but this case is an exception and it is possible with
application of standard AEC-HIC-SEC protocol. However it was suspected that protein is losing
some of flavin during HIC step and it was replaced with second AEC using different matrix
(DEAE Toyopearl or Resource Q) and pH. Purity of the protein is lower in this case (about
80%) and preps have one significant contamination (a few %) of 20kDa protein.
16mS/cm
Spectra were measured for red fractions and ratio A412/A276 was calculated:
Fr A412/A276 (R)
25 0.18
26 0.32
27 0.36
28 0.32
29 0.25
Fractions with highest ratio, 26-28, were combined: V=15ml, C=4.35mg/ml, 65mg, R=0.33
81
Sample was diluted with water to conductivity 6mS/cm and applied on a 6ml Resource Q
column.
Flow rate 5ml/min, fractions 2.5ml. Gradient: 90 ml 50-250mM NaCl in 50mM MES pH 6.5.
11mS/cm
Spectra were taken from red fractions and peaks ratio was calculated
Fr A405/A280
14 0.66
15 0.77
16 0.86
17 0.82
19 0.64
Fractions 15-17 were combined: V=7.5ml, C=1.25mg/ml, 9.3mg R=0.82
Volume was reduced (using VivaSpin) to 1.25ml, C=7mg/ml, 8.5mg and was applied on a
1.6x60cmSuperdex200 column equilibrated in 0.5M NaCl, 50mM tris-HCl pH 8.0 buffer.
Flow rate1.5ml/min, fractions 2ml.
82
Purification progress was analysed by SDS-PAGE (NuPage 4-12% BT Novex gel )
1 2 3 4 5 6 Mark 12 MW
1. Cell debris standards
2. CFE
[Link] DEAE
4. After Resource Q
5 Final prep
6. Mark 12
83
R=0.95 R=1.2
R=1.2
84
3. Almost typical three step purification
Glutamate dehydrogenase from Clostridium symbiosum
ProtParam results for the target protein:
MW 49296 Da
pI 5.1
Abs 0.1% (1mg/ml) 1.195
GluDH was over expressed in BL21 (DE) cells. Analysis of over expression revealed a very high
level of soluble expression. Typically for such a high level of expression a significant band of
GluDH was also found in the cell debris.
1 2 3
1. Mark 12 MW standards
2. Cell debris (pellet)
kDa 3. Cell free extract
55
36
Cell free extract was prepared in Buffer A (50mM tris-HCl pH 8.0) from about 2g of defrosted
cells as described in the Protocol number 2.
CFE: V=23ml, protein concentration (by Bradford, Protocol number 9) = 5.5mg/ml,
total protein 125mg.
CFE was applied on a 5ml Hi Trap DEAE FF cartridge washed with 5ml of BufferA and proteins
were eluted by 50ml (10CV) gradient 0-0.5M NaCl in Buffer A at flow rate 4ml/min. 2ml
fractions were collected. Protein concentration was measured in fractions by method of Bradford
and fractions with protein were analysed by SDS-PAGE (Novex Nu-Page BT 4-12% gel). (see
chart and gel picture below).
Unbound
material
CP CFE 4 10 12 14 16 17 18 19 20 21 22 24 fractions
85
GluDH were eluted as a broad peak due to a very high expression, also some of the GluDH was
found in the unbound material, which also is not unusual for heavily expressed proteins. Column
volume has to be doubled in this case (two 5ml cartridges screwed together) to improve protein
binding and yield.
Fractions 17-22 were combined, volume 12ml, C=4.5mg/ml, total 54mg.
The sample was supplemented with 7.2ml of 4M ammonium sulphate to bring ammonium
sulphate in the sample to 1.5M and applied on a 5ml Phenyl-HP cartridge. Elution was done by
50ml (10CV) of the reverse gradient of concentration of (NH4)2SO4 from 1.5M to 0 in Buffer
A at flow rate 5ml/min. 2ml fractions were collected.
On this stage the peak is very obvious, A280 corresponds to protein, fractions to combine are
easy to identify as 22-24. SDS-PAGE is not essential here and was done later just for
demonstration.
Phe-HP 20 21 22 23 24 25 26 28 31 Fractions
GluDH was eluted from column with 0.65M ammonium sulphate, which was found by
measuring the refraction in fraction 23. This means that optimal gradient for this protein is from
1-0.9M to 0 of ammonium sulphate while length of gradient could be reduced to 40ml (8 CV).
Fractions 22-24 were combined, volume 6ml, protein concentration 2.7mg/ml, total protein
16mg.
The volume of the sample was reduced to 2ml using Viva Spin concentrator 30000 MWCO and
sample was applied on a gel filtration column, 1.6x60cm HiLoad Superdex200.
Gel filtration was performed in buffer 0.5M NaCl, 50mM tris pH 8.0 at flow rate 1.5ml/min.
2ml fractions were collected after void volume. GluDH was eluted at 60.3ml with apparent MW
290kDa, which indicates that GluDH is a hexamer. Once again, there are two obvious fractions
to harvest, 11 and 12.
Fr 11+12: V= 4ml, C=1.7mg/ml, 7mg totally.
GFl 10 11 12 13 14 fractions
86
SDS PAGE (Novex BT 4-12% gel) was performed to analyse progress of the purification.
In this case, despite a very high expression, two purification steps were not enough to
reach acceptable purity. This is because on both AEC and HIC GluDH elutes with the
majority of other proteins. In this case gel filtration works very well, due to hexameric
state of the GluDH molecule.
The protocol works very well with much lower expression level:
Mark 12 MW
standards
87
4. Monitoring purification by enzyme activity
Glutamate dehydrogenase from Clostridium symbiosium
Here I would like to show how purification can be performed based on enzymatic activity of a
target protein. GDH is a good example because activity assay is very simple and quick.
Activity assay:
1mM NAD, 20mM Na glutamate, 50mM K Phosphate pH 7.0. NAD reduction to NADH can
be monitored by absorbance at 340nm.
Mixture composition:
0.96ml KPhosphate buffer
20µl 1M Na Glu
10µl 0.1M NAD
1-20µl GDH solution
Absorbance at 340nm is monitored for 1-2 minutes. Change in absorbance is used to calculate
NADH production using extinction coefficient 6220M-1cm-1.
Purification procedure
CFE was prepared in 0.1M K Phosphate pH 7.0 on this occasion. C=9.5mg/ml, V=9ml, total
protein 85mg. Specific activity in CFE was found to be 8.0u/mg. Total activity 680u.
CFE was diluted fourfold to reduce ionic strength and was applied on a 5ml DEAE FF cartridge.
Chromatography was performed on AKTA purifier system at flow rate 4ml/min. Elution was
performed with 50ml gradient of NaCl concentration from 0 to 0.5M in 20mM K Phosphate
pH 7.0 buffer. 2.5ml fractions were collected.
u/ml
u/mg
50
10
30
6
10 2
88
Activity was measured in every third fraction to the point when activity was found and then
activity and protein concentration were measured in each fraction as shown below:
Fractions 15-19 with highest specific activity were combined: V=12.5ml, C=3.45mg/ml, 43mg,
7.1u/mg, 305u
Sample was supplemented with 1M ammonium sulphate and applied on a 5ml Phenyl-HP
cartridge. Elution was performed by 50ml of reverse gradient of ammonium sulphate
concentration from 1.2 to 0M in 20mM K Phosphate buffer. 2 ml fractions were collected.
u/ml u/mg
89
Volume of the sample was reduced to 1ml using VivaSpin and applied on a 1.6x60cm
HiLoad Superdex200 gel filtration column.
Gel filtration was run at flow rate 1.5ml/min in 0.1M K Phosphate pH 7.0 buffer. 2ml
fractions were collected.
Peak fractions 10+11 were combined: V=4ml, C=2.4mg/ml, 9.8mg. Specific activity 21.7u/mg.
Summary:
90
5. Power and failure of dye pseudo affinity chromatography
Phenylalanine Dehydrogenase from Nocardia sp.
Purification of PheDH from Nocardia sp. is interesting example of the protein purification from
the native source. PheDH was naturally over expressed in the Nocardia cells by growing culture
in the presence of phenylalanine. Half a kilo of the cell paste was sent to us from Proton Down
alongside with the simple one step purification protocol which employed pseudo affinity
chromatography on a Procion Red HE-3B Sepharose4B. A pot of the matrix was also included.
This type of chromatography often is used for purification of dehydrogenases because of
similarity in molecular structures of dye and NAD, one of the dehydrogenase substrates.
Purification protocol suggested that CFE to be applied on a Red column in 50mM tris buffer
pH 8.5, unbound material to be removed by washing the column with the starting buffer and
then PheDH to be eluted bio specifically with 1mM NADH in the same buffer.
According to the protocol CFE was prepared from 50g of cell paste in 50mM tris buffer pH 8.5
by the standard procedure (Protocol 2).
CFE: V=180ml, C=15mg/ml, total protein 2700mg.
Monitoring of the target protein in this case was done by activity. There is a fast and easy assay
based on monitoring of NADH produced in reaction of oxidative deamination of phenylalanine
by measuring absorbance at 340nm.
The specific activity in the CFE was found to be 0.1U/mg, suggesting level of expression of
PheDH was about 2% of total protein.
Red Sepharose chromatography: Sample of 80ml of CFE (1200mg total protein, 120U
activity) was applied on a 30ml Red Sepharose column at flow rate 3ml/min. Column was
washed with the starting buffer (50mM tris-HCl pH 8.5).
Unbound fraction: V= 150ml, 4.5mg/ml, total 675mg, 66U activity. It was clear that something
is not right: just 50% of total protein was found instead of expected 90% or so and also specific
activity in this fraction was the same as in the CFE. It looked like half of the protein was bound
to the column non-specifically. Active fractions
1 2 3
Elution was performed with 1mM NADH. 8ml fractions were collected and
checked for activity. Activity was found in three fractions and was just 8U in
total. Specific activity was 1.8U/mg. SDS-PAGE (10% Laemmly gel) analysis
reveal purity not better then 60-65%:
So, 80% of bound PheDH was stacked on the column irreversibly, yield of the
chromatography was 6.6% and a lot of protein was bound to the column non-
specifically.
Further purification was attempted employing gel filtration on a 1.6x60cm
Hi-Load Superdex200 which resulted in 2mg prep with specific activity
2.9U/mg. SDS-PAGE analysis suggested about 75% purity. (See below,
Preparation 1).
So, Dye chromatography failed and most likely particularly batch of the home made matrix
was to blame. Commercial Red Sepharose CL-6B was ordered from Pharmacia (now GE
Healthcare) for comparison.
What may be wrong with the matrix? The fact that half of material was bound to the column
non-specifically most likely is due to that “aggressive sites” in the matrix which was a common
knowledge among biochemists on early days of protein purification, when cellulose based
matrixes were in use. Sepharose normally is much better in respect with non-specific binding,
but it was subjected to some drastic conditions (like NaOH) during the dye binding which could
lead to such an “aggressive sites”. The method to fight a problem is to saturate these sites with
the protein. In hope that saturation was achieved during the first chromatography I give the
column the second chance. But on a way I decided to try IEC as well using the material that was
not bound to the column on the first run.
91
Anion exchange chromatography. Flow through fraction from Red column (675mg of total
protein, 66U of activity) was applied on a 25ml DEAE-Sepharose column; elution was
performed by 300ml NaCl gradient from 0 to 0.4M NaCl in 50mM tris-HCl buffer pH 8.5. 8ml
fractions were collected and checked for activity. Active fractions containing 140mg of total
protein, 49U activity, 0.35U/mg. Purification fold is 3.5 which is reasonable, but not very high.
Red Sepharose. Sample obtained after DEAE chromatography was concentrated to 4.5ml and
applied on a 30ml Red-Sepharose column . Column was washed with 50mM tris-HCl buffer pH
8.5 and PheDH eluted with 1mM NADH. This time activity was bound to the column and
successfully eluted, given 7.9mg of total protein and 24U activity. SDS-PAGE analysis revealed
purity on this stage being about 80-85%:
1 2 3
Still PheDH yield on this stage was 50% which was an improvement from 6.6%, but what we
expect from affinity chromatography is 70-90%, so seems some of protein still was stacked to
the matrix.
For further purification sample was concentrated and subjected to gel filtration. Combined
active fractions contained 4.8mg of protein with specific activity 3.4U/mg. Purity estimated by
SDS-PAGE was about 90%. (See gel below, Preparation 2)
The remaining 100ml of the CFE (1500mg of total protein, 150U activity) was subjected to 3
step purification protocol.
AEC: chromatography was done on a 25ml DEAE-Sepharose column, gradient 300ml from 0
to 0.4M NaCl, 8ml fractions were collected and checked for activity. Active fractions were
combined, in total 122U of activity, 380mg of total protein, specific activity 0.32U/mg.
AS cut:AmSO4 was added to the sample to 1.4M. Significant pellet was removed by
centrifugation. No activity was found in the pellet. In the supernatant fraction there was 270mg
of total protein with specific activity 0.4U/mg, 108U.
HIC: Sample was applied on a 25ml Butyl-Toyopearl column and eluted by 300ml of gradient
of ammonium sulphate from 1.4 to 0 in buffer A. Activity was found in fractions eluted with
about 0.3M ammonium sulphate. Two fractions with the highest specific activity were
combined, 15mg total protein, purity by SDS-PAGE about 40%:
1 2 3 4 5 6 7
1. Mark12 MW standard
2. CFE
3. DEAE-Sepharose
4-7. Butyl-Toyopearl fractions
with PheDH activity
92
SEC:Sample was concentrated and applied on a gel filtration column equilibrated in 50mM tris-
HCl pH 8.5. 2ml fractions were collected and analysed for activity and protein concentration.
Three fractions with the highest activity were combined, yielded in 5mg of the protein with
specific activity 2.5U/mg, about 60% purity estimated by SDS-PAGE:
1 2 3 4 5 6 7
1. Mark 12
2. Sample applied on a gel filtration
column
3-7. Fractions across activity peak
With a target protein still not pure and with a little option left I have attempted to employ Red
column on this stage. Sample obtained after gel filtration was applied on a 15ml Red –Sepharose
(commercial, from Pharmacia) column and this time activity was bound to the column and after
elution with 1mM NADH 3.8mg of PheDH was obtained with specific activity 3.6U/mg and
apparent purity on SDS-PAGE better than 90%. (Preparation 3). Still very low yield, but at
least purity was OK.
Comparison of the three preparations:
Preparations 1 2 3 Prep Specific Purity Yield
Activity by SDS-PAGE
Apparently method 2 was the best, but the disadvantage of this one was that we still need to use
big Red-Sepharose column and spend about 60ml of expensive NADH for elution.
Later I have found way to improve ammonium sulphate cut and even without Red
chromatography about 80-85% purity of the PheDH preparations could be achieved with “3step
protocol”. Purity was good enough for crystallisation. However, later we had attempted to
obtain amino acid sequence of the protein by Edman degradation. For that purpose high purity
of the protein was essential and Red chromatography was back, but on a smaller column, with
less NADH to be spent.
The typical purification procedure of PheDH from Nocardia is presented below.
Fractions 16-28 were combined, V=92ml, total protein 662mg, 170U activity.
AS cut: 73ml of 4M ammonium sulphate were added to bring AS concentration to 1.8M. Pellet
was spun down and dissolved in Buffer A. 4M AS solution was added to the sample to bring AS
concentration to 0.9M. Pellet was spun down.
HIC: Supernatant fraction containing 227mg of total protein and 152U of activity was applied
on a 25ml column with Butyl-Toypearl 650S, equilibrated in BufferA+0.9M AS at flow rate
3ml/min. Elution was performed with 250ml of reverse gradient of AS in Buffer A from 0.9M to
0. 7ml fractions were collected and analysed for activity and protein concentration:
Fractions 22-24 were combined, total 37mg and 81U of activity and volume was reduced to 1.2
ml using Viva Spin concentrator 30000MWCO.
SEC: Sample was applied on a 16x60 HiLoad Superdex200 column equilibrated in 50mM tris-
HCl buffer pH 8.5. Gel filtration was done at flow rate 1.45ml/min. 2ml fractions were collected
(see chart below).
94
A280
2 3 4 5 6 7 8 9 10 11 12 13 14 fractions
10 20 30 40 50 60 70 80 ml
Three peak fractions (10-12) were combined (18mg of total protein) and applied on a 10ml
column with Red-Sepharose (Pharmacia) at flow rate 1ml/min. Column was washed with 15ml
of buffer 50mM tris-HCl pH 8.5 and then eluted with 1mM NADH in the same buffer:
[Protein] 1.5
A280 mg/ml
1.0
0.5
5 10 15 fractions
95
Purification process was analysed by checking specific activity on each purification step (see
table below) and also by SDS-PAGE (4-12% BT Novex gel)
1 2 3 4 5 6 7
1. CFE Mark 12 MW
standards
2. DEAE-Sepharose
3. AS cut
4. Butyl-Toyopearl
5. Gel filtration
6. Red Sepharose
7. Mark12 MW standard
96
Glutamate dehydrogenase from Clostridium symbiosum again
Dye chromatography versus three step purification protocol
Unlike majority of NAD-binding proteins Glutamate dehydrogenase from Clostridium
symbiosum does not bind to commercial Red Sepharose which has Procion HE-3 dye cross
linked.
However it can be purified using different red dye, Remazol red (Syed et all., 1991, BAA,
v.1115, p. 123)
So, 1.95mg (97%) of total protein and 21u (95%) of activity was recovered.
Column seems was overloaded with GDH, so, capicity of matrix was about 0.25-0.3mg GDH
per ml.
97
Preparative purification:
Three step protocol (see Show cases, cases 3 and 4) versus Remazol-Sepharose
CFE prepared in KP pH 7.0 buffer was defrosted and filtred through 0.45µ filter:
V=12ml, C=6.7mg/ml
CFE was divided in two portions, 6ml (40mg of total protein) each.
Three step protocol
Anion exchage chromatography: 40mg of CFE was diluted three fold and applied on a 5ml
DEAE FF cartridge in buffer 20mM KP pH 7.0. Elution was performed by 50ml of gradient of
NaCl concentration from 0 to 0.5M. 2.5ml fractions were collected and analysed for activity (see
case 4 for assay composition).
Active fractions 14-19 were combined, V=15ml, C=1.3mg/ml, 19.5mg, suplimented with 1M
ammonium sulphate and applied on a 5ml Phenyl-HP cartridge.
Hydrophobic chromatography: Elution was done by 50ml of reverse gradient of AS
concentration from 1-0M in 20mM KP pH 7.0. 2.5ml fracttions were collected.
Based on elution profile fractions 21-24 were combined, V=10ml, C=0.67mg/ml, 6.7mg
Volume was reduced using Viva Spin with MWCO 50000 to 1ml, C=5.4mg/ml, 5.4mg.
Gel filtration : Sample was applied on a gel filtration column (1.6x60 HiLoad Superdex200)
equilibrated in 0.5M NaCl, 50mM tris pH 8.0 (standard GF buffer).
Flow rate 1.5ml/min.2ml fractions were collected.
98
Fractions 8-10 were combined: V=6ml, C=0.56mg/ml, 3.4mg ( Final prep 3sp)
Remazol-Sepharose purification
20ml column was made for purification. Preliminary experiments have shown that new unused
matrix have capicity about 0.5mg GDH per ml of matrix, so expected output from this column
could be up to 10mg.
Dye chromatography: CFE (6ml, 40mg of total protein) was applied on a 20ml Remazol-
Sepharose column eqilibrated with 0.1M KP pH 7.0 at flow rate 3ml/min. Column was washed
with 30ml of the starting buffer and then GDH eluted with 1M NaCl in the same buffer. 5ml
fractions were collected.
Fractions were analysed for activity. No activity was found in fractions 2-11. Fractions 12-14
with all activity were combined: V=15ml, C=0.56mg/ml, 8.4mg
Gel filtration: Sample was reduced in volume to 1ml (C=7.5mg/ml) and additional gel filtration
step was applied. All conditions as above.
99
Fractions 8-10 were combined: V=6ml, C= 0.9mg/ml, 5.4mg (Final prepRS)
1 2 3 4 5 6 7 8 Mark 12 MW
standards
1. Mark12
2. CFE
3. After DEAE column
4. After Phenyl-HP column
5. GF loading
6. Final prep 3sp
7. Fr 12-14 Remazol Sepharose
8. Final prep RS
When compare line 6 (3 step protocol) with line 7 (Remazol-Sepharose prep) we can see that
purity of the first one is noticeably higher. After additional GF step for the RS prep there still are
a number of small contaminating bands, but purity now looks a little bit higher than for 3 step
prep.
Activity analysis
Despite simplicity of performing the activity assay there is a significant problem when we want
to measure activity accurately to obtain reliable figures for specific activity to compare different
enzyme preparations. The problem is that kinetics of the reaction in this case is not linear and so
it is practically impossible to measure initial velocity. It is also seems that NAD concentration is
not saturating under commonly used activity assay protocol (1mM NAD, 20mM NaGlu, 0.1M
KP pH 7.0). I found that saturated concentration is 10mM NAD.
100
To achieve more or less linear kinetics under the standard assay conditions the concentration of
enzyme has to be as low as it practically possible.
I found that the best way to compare activity of different samples is to dilute them in order to get
similar and relatively low activity around 5u/ml. Kinetics becomes almost linear in this range.
In my experiments I used spectrophotometer which could be programmed to make calculations
of activity. I have prepared a number of dilutions of the enzyme sample to get readings around
5u/ml and then I used dilution factor to calculate activity in the original sample. Data obtained
this way are presented in the table below.
Verdict
Yes, yield with one step purification is significantly higher, while purity is lower. The strange
observation is that Specific activity of the two preps is the same, while purity estimated by SDS-
PAGE is higher with 3step protocol. The reason probably is that not all molecules of GDH are
active and so have not got affinity to Remazol.
Still with the preparative red column the yield was not as high as for small analytical run.
However analytical experiment result was too good to be true.
So, if you have ready remazol column of appropriate size, it is better to go for Remazol
protocol. In case if you only need to purify this protein once or twice, the amount of time and
effort to make the Dye column is not worthily.
Another issue is the Specific activity. In my hands under the same conditions as reported in
foundation Syed at al. paper Specific activity for clostridium GDH purified by Remazol
Sepharose falls in range 30-35u/mg, while they reported figure just 18.3u/mg. This is because
real initial velocity is really difficult to determine for this GDH. The lesson I took from this
experience was do not take Specific activity reported in the papers too seriously.
Also here rises the question:
Can Specific activity be good measure for purity as it was taken in the past? (For sure, prep on
line 6 does not look to be 25% less pure then the prep on line 8)
101
6. DNA binding proteins
Typical Heparin purification: RuvC from phage bIL67
Ruv C proteins are crossover junction endodeoxyribonucleases (nucleases that resolves Holliday
junction intermediates in genetic recombination).
RuvC from phage bIL67:
MW 18097 (dimer)
pI 7.64
Large scale purification
CFE was prepared in buffer 50mM tris pH 8.0, 0.25M NaCl from 7.5g of cell paste. Extra
sonication cycle was applied and centrifugation time was extended in order to obtain CFE at
higher than usual concentration.
CFE: V=42ml, C=12.5mg/ml, 525mg
Heparin Chromatography. CFE was applied on 5ml Heparin HP cartridge. AKTA purifier
system was used for purification.
Flow rate 5mg/ml. Fractions 2.5ml. Gradient: 75ml (15CV) 0.25-2M NaCl in 50mM tris pH 8.0
Fractions were analysed for protein concentration and fractions with highest concentration
20+21 were combined: V=5ml, C=10mg/ml, 50 mg
Volume was reduced to 2ml using VivaSpin MWCO 10000: V=2ml, C=23mg/ml, 46mg
Gel filtration. Sample was applied on a 1.6x60cm HiLoad Superdex200 column equilibrated in
0.5M NaCl 50mM tris pH 8.0 buffer. Flow rate 1.5ml/min. Fractions 2ml
.
Apparent MW
40kDa
102
Fractions 7-9 were combined: V=6ml, C=6mg/ml, 36mg
Purification progress was analysed by SDS-PAGE using NuPage 4-12% BT Novex gel:
1 2 3 4
1. Mark12 Mark 12 MW
2. CFE standards
3. GF loaded
4. Final prep
Summary:
This is an example of typical purification of DNA-binding protein. Often Heparin +GF protocol
works satisfactory allowing to produce 80-90% pure protein suitable for structural studies.
Good expression level and relatively high affinity to Heparin allow to purify RuvC
endonuclease to purity of about 90% .
103
Playing with solubility: LrpC from Bacillus subtilis
LrpC was over expressed in [Link] cells to a good level (10% or higher).
Cells were disrupted in 50mM tris-HCl pH 8.0 buffer and pellet was collected by centrifugation
as usual (Protocol 2).
CFE contained 700mg of total protein and had practically no LrpC (see resulting gel).
Extraction of LrpC from cell debris. Pellet was suspended in 7ml of buffer with 1M NaCl,
50mM tris-HCl pH 8.5. Sample was stirred for 1hour at 4oC. Insoluble material was spun down
at 70000g for 10 minutes. Supernatant fraction contained 90mg of total protein (V=9ml,
C=10mg/ml)
Precipitation of LrpC with ammonium sulphate. 14ml of 4M AS was added to bring AS
concentration to 2.5M. LrpC precipitated and was collected by centrifugation as above. Pellet
was dissolved in 7ml of 50mM tris pH 8.0 and clarified by centrifugation as above.
V=8ml, C=11mg/ml, 88mg (about 0.3M AS).
Gel filtration. Sample was divided to 3 portions and gel filtration was performed on 1.6x60cm
HiLoad Superdex200 column equilibrated in buffer 50mM tris-HCl pH 8.0, 1M NaCl
2ml fractions were collected in the same set of tubes for each of 3 runs.
Fractions 14-19 were combined: V=35ml, C=2mg/ml, 70mg. Purity estimated by SDS-PAGE
was better than 90% (see gel below).
Apparent MW
78kDa
1 2 3 4 5 6
Purification progress was analysed by SDS-PAGE, using
NuPage 4-12% BT Novex gel:
1. Mark12
2. CFE obtained in 50mM tris-HCl pH 8.0
3. Cell pellet suspended in 1M NaCl
4. 1M NaCl extract (after centrifugation)
5. GF load (2.5MAS pellet dissolved and clarified)
6. Final prep
104
Heparin and solubility:
FrmR from Escherichia coli
FrmR is transcriptional repressor, sensor for formaldehyde.
MW 10318 Da, forms tetramer
pI 5.84
FrmR comes to me with the purification protocol which included Heparin chromatography,
ammonium sulphate precipitation and gel filtration. I was told that protein needs 0.3M of NaCl
to stay in solution and 10mM DTT and EDTA to keep it active. I quickly found that FrmR has
low affinity to Heparin column at 0.3M NaCl and in order to have it bound to the Heparin-HP
cartridge I had to decrease NaCl concentration to 0.1M. No FrmR was precipitated. In fact
0.3M NaCl appeared to be eluting concentration. Later I decided to simplify my life by
exclusion of DTT and EDTA from gel filtration buffer and started to run gel filtration in our
standard buffer 0.5M NaCl 50mM tris-HCl (so I saved 2 hours on equilibrating - re-
equilibrating the column). It did not affect activity. So I decided to try to remove DTT and
EDTA from the purification what so ever. Once again, as for a number of proteins before,
DTNB reaction proved that all 4 cysteins in the FrmR preparation were reduced despite absence
of DTT during purification. The protein was active and we have good publication on the
structure-function of this protein.
However, preparations of FrmR purified by Heparin–GF two step protocol contained significant
amount of 40kDa contamination (see gel below)
1 2 3 45 1. Mark 12
2. Cell Debris
3. CFE
4. After Heparin
column
5. Final preparation
To improve purity I decided to try to use low solubility of the protein at low salt conditions.
Dialysis in 50mM tris-HCl pH 8.0 buffer was performed on a sample obtained after Heparin
chromatography and majority of FrmR went out of solution in form of micro crystals. However,
it appeared that for successful crystallisation FrmR protein concentration has to be at least
3mg/ml, otherwise significant amount of FrmR was left in solution. Also crystallisation was
found to be temperature depended, so dialysis was performed at 4oC. Crystals were collected by
centrifugation and dissolved in 50mM tris buffer pH 8.0 containing 1M NaCl. Solubility under
these conditions appeared to be more than 40mg/ml. For the best result sample was gel filtered.
Purity of the resulting preps was typically better than 90-95%. To prevent crystallisation or
precipitation final preparations obtained at high concentration in the presence of 0.5M NaCl had
to be kept at room temperature.
Typical purification is presented below.
105
FrmR purification 30.3.16
Cells obtained from 1l culture were used to prepare CFE in buffer 0.1M NaCl, 50mM tris-HCl
pH 8.0 by a standard protocol (Protocols, 2).
CFE: V=15ml, C=7.5mg/ml, total protein 110mg
Heparin chromatography: CFE was applied on a 5ml Heparin-HP cartridge equilibrated in the
same buffer. Chromatography was performed on AKTA purifier system at flow rate 5ml/min.
Elution was achieved by 50 ml of gradient of NaCl concentration from 0.1 to 0.7M in 50mM
tris-HCl pH 8.0 buffer. 2.5ml fractions were collected.
Fractions were analysed for protein by method of Bradford and peak fractions 13-15 were
combined: V= 7.5ml, C=3.3mg/ml, 25mg.
Crystallisation: Protein concentration in this case was high enough and so sample was
subjected to dialysis without additional concentrating.
Sample was dialysed against 0.5l of 50mM tris-HCl pH 8.0 (Buffer A) over night in the cold
cabinet (at 4oC).
Micro crystals were collected by centrifugation (5 minutes 21000g) and dissolved in about 1ml
of 1M NaCl in Buffer A: V=1.6ml, C= 8.55mg/ml, 13mg
Gel filtration: Sample was applied on a 16x60HiLoad Superdex200 column equilibrated in
Buffer A +0.5M NaCl. Gel filtration was run at flow rate 1.5ml/min. 2ml fraction were
collected.
Apparent MW
45kDa
106
Fractions 7-9 were combined: V=6ml, C=2mg/ml, 12mg
FrmR was concentrated using VivaSpin with MWCO 30000:
V=0.43ml, C=18.5mg/ml, 7.8mg
SDS-PAGE analysis:
NuPage 4-12% BT Novex gel with MES running buffer:
1 2 3 4 5 6
1. Mark12
2. CFE
3. After Heparin column
4. Supernatant fraction after dialysis
5. GF loading (micro crystals dissolved in 1M NaCl)
6. Final preparation
Mark 12 MW
standards
107
Real power of Heparin: Human Flap endonuclease
Over the years we worked with a number of Flap endonucleases from different organisms
in collaboration with Dr Sayers from Medical school. Typically for crystallisation they
were purified using Heparin-GF or Heparin-IEC protocol. Most of them were over
expressed in [Link] to a reasonable level (at least 2-3%, so you can see the band in CFE
sample on SDS-PAGE). Human FEN was different as expression level was low and
practically insoluble, so it was impossible to identify certain band corresponding to FEN
in CFE on SDS-PAGE gel.
hFEN
MW 42593Da
pI 8.8
This protein is also interesting as it came to me with the most ridiculous purification
protocol I have ever seen.
Cells were suspended in tris buffer pH 8, 2mM EDTA, 0.2M NaCl and 5% glycerol.
Lysozyme (0.2mg/ml!!!!) was added and cells incubated for 20 minutes on ice
PMSF (23µg/ml) was added and cells were incubated 40 minutes at room temperature
Na-deoxycholate (0.5mg/ml) was added and incubated for 20minutes at room temperature
DTT (1mM) was added and incubated for 5 minutes
Sonication: 20% amplitude, 5sec bursts for 30 sec (not sure what that means???), repeated
three times
Centrifugation: 25000rpm at 10oC for 20 minutes
Ammonium sulphate was added to 0.5M
5% PEI (Polyethylenimin) precipitation was performed with mixing for 10 minutes
Pellets were removed by centrifugation at 25000rpm for 15 minutes
Supernatant was dialysed in buffer 20mM KP pH 6.0, 1mMDTT, 2mM EDTA, 5%
glycerol at 4oC over night
Heparin chromatography (0.1-1M NaCl gradient in above buffer)
Fractions with FEN were pooled and a 55% AS precipitation was performed for 2h at 4oC
Pellets were removed by centrifugation and supernatant fraction was dialysed in 20mM
tris buffer pH 8, 1mM DTT, 2mM EDTA, 5% glycerol (I guess overnight)
The sample was run trough Q column and unbound fraction was collected.
Sample was dialysed again in KP buffer pH 6.0, 50mM NaCl
Sample was applied on a combination of HiTrap SP and Heparin columns
No details how proteins were eluted. !!!!
It seems, the purification takes four days. It includes many manipulations of unclear
purpose and looks like mixture of ritual actions and sporadic desperate moves...
We purified it by Heparin-Cation Exchange Chromatography to about 85% purity, good
enough for successful crystallisation.
hFEN purification
6g of cells were defrosted and CFE was prepared in about 40ml of buffer 0.2M NaCl
50mM tris-HCl pH 8.0. The standard protocol was amended due to high concentration of
cell suspension: sonication was performed in three cycles instead of two and
centrifugation was run at 70000g for 15 minutes instead of ten.
CFE: V=35ml, C=11mg/ml 380mg
108
Heparin Chromatography. CFE was applied on a 5ml Heparin-HP column. Flow rate
4ml/min. 2.5ml fractions were collected. Elution was performed by 75ml gradient of 0-1M NaCl
concentration in 50mM tris-HCl pH 8.0 buffer.
1 2 3 4 5 6 7 8
Mark 12 MW
standards
1. Mark12
2. Cell debris
3. CFE
4. Heparin unbound fraction
5. Heparin fr20-23
6. Pellet occurred at pH 6.3
7. Sample applied
on a Resource S column
8. Fr 14+15 from Resource S
(final preparation)
Purity of the final preparation is about 85%. Yield is 2.6mg. Presuming 2 step purification
has typical yield 50%, there was about 5mg of hFEN in CFE, which is 1.3%
(5:380=0.013).
As you can see on gel there is some hFEN in cell debris, but it is difficult to find right
band in CFE sample. Still, it was possible to purify hFEN to reasonable purity just in 2
step purification thanks to its affinity to Heparin and also its basic pI. It also was lucky to
get significant amount of contaminations precipitated at pH 6.3.
110
In need of nuclease treatment: SfsA
SfsA is sugar fermentation stimulation protein which function is positive regulation of
transcription, DNA-templated. We had studied structure of SfsA from two organisms,
Pyrococcus furiosus and Escherichia coli. This protein when over expressed in [Link] was
found to interact with DNA very strongly. Nuclease treatment was needed to make the whole
pool of TP to bind to Heparin, as described below.
However later we needed nuclease free sample for DNA-Protein complex studies. Ammonium
sulphate precipitation was employed with good degree of success (see below).
SfsA P. furiosus: SfsA [Link]:
MW: 26114 MW: 26229
pI: 9.3 pI: 6.5
A0.1%: 0.4 A0.1%: 1.14
We started our study with Pyrococcal SfsA.
First CFE was received from collaborators in 50mM NaPhosphate pH 8.0.
About 30mg of the CFE was applied on 1ml Heparin-HP cartridge and eluted with 20ml of 0-
1.5M NaCl gradient in Buffer A (50mM trs-HCl pH 8.0). 0.8ml fractions were collected and
analysed by Bradford and SDS-PAGE:
M12 CFE FT 10 12 14 16 18 20 22 24 26 Fr
111
SfsA from P. furiosus purification 12.9.11
CFE from 2litre culture cells was prepared in buffer 20mM NaCl, 2mM MgCl2, 50mM tris-
HCl pH 8.0, 250 u of Benzonase was added and sample was dialysed against above buffer at
4oC over night.
CFE after nuclease treatment ( V=31ml, C=4mg/ml, 124mg) was heated at 70oC for 20 minutes.
Precipitate was removed by centrifugation (70000g, 10 minutes).
Sample after heat treatment (V=31m,l, C=1mg/ml, 31mg) was applied on a 5ml Heparin HP
cartridge.
Heparin chromatography: Chromatography was performed on AKTA purifier system at flow
rate 5ml/min. Elution was done by 50ml (10CV) of gradient of NaCl concentration from 0 to
1.2M in BufferA. 2.5ml fractions were collected.
Fractions 20+21 were combined: V=5ml, C=3mg/ml, 15mg and concentrated using Viva Spin
MWCO 10000 to 1ml.
Cation exchange chromatography: Sample was diluted in 15ml of 50mM MES-NaOH pH 6.5
buffer and applied on a 1ml Resource S column. Flow rate 2ml/min. Gradient: 18ml, 0.25-0.7M
NaCl in above buffer. 0.5ml fractions were collected.
1 2 3 4 5 6 7 8
112
Similar protocol was applied for purification of [Link] SfsA except of heat treatment:
CFE→Benzonase treatment→Heparin→Resource S. Cation exchange chromatography worked
on [Link] SfsA protein despite its theoretical pI 6.5.
CFE was prepared in 20mM NaCl, 5mM MgCl2, 50mM tris-HCl pH 8.0 buffer and treated with
Benzonase over night as described above.
CFE: V=35ml, C=2.45mg/ml, 86mg
Heparin chromatography. Flow rate 5ml/min. Gradient: 75ml (15CV) 0-1.5m NaCl in 50mM
tris-HCl pH 8.0. Fractions 2.5ml.
1.Mark12
Purity of final preparation in this case is lower
[Link] debris than for Pyrococcal SfsA, about 80-85%, but it
[Link] is good enough for structural studies.
4. Heparin flow
through Yield is also good, 11% of total CFE protein
5. After Heparin
6. Final prep
113
Nuclease free purification of [Link] SfsA
CFE was prepared from 5g of cells in 1M NaCl, 50mM tris-HCl pH 8.0 buffer.
CFE: V= 30ml, C=10mg/ml, 300mg
Heparin chromatography 1: CFE was diluted 5 fold with 50mM tris pH 8.0 buffer and applied
on a 5ml Heparin-HP column. Chromatography was performed as described above yielded in
9.6mg.1ml Resource S column was used for the second chromatographic step producing 1.7mg
of the TP. Gel analysis revealed that SfsA was not pure and so gel filtration was applied for
further purification. SDS-PAGE analysis is presented below.
HepFT 1.5 2.0 2.5 3.0 3.5M AS pel
Only 0.3mg of TP was obtained
1 2 3 4 5 6 7
1. Mark 12 after GF with purity not better than
2. Cell Debris 70%.
3. CFE
4. Heparin flow
It was not enough material for the
through experiments and so attempt was
5. After Heparin made to purify TP from the Heparin
6. After Resource S
7. After GF
unbound material as it was a lot of
SfsA revealed in this fraction.
Analytical ammonium sulphate cut
(protocol 4) was performed on this
material.
SfsA starts to precipitate with 2.0M
AS and still is presented in 3.5M
pellet.
AS cut:43 ml of 4M AS was added to 65ml of Heparin 1 flow through fraction (2mg/ml, 130mg
of total protein) (1.8M AS). Precipitated material was removed by centrifugation (5 minutes at
70000g). 21g of AS powder was added to a supernatant fraction gradually with stirring at 4oC to
bring AS concentration to about 3.2M. Solution was incubated for 10 minutes and precipitated
material was collected by centrifugation as above. Pellet was dissolved in 40ml of 50mM tris-
HCl pH 8.0 buffer (conductivity 18.8mS/cm, total protein 80mg) and applied on a 5ml Heparin-
HP column.
Heparin chromatography 2: Chromatography was performed as described before.
Fractions 19-22 were combined, V=10ml, C= 0.72mg/ml, 7.2mg and concentrated to 1ml.
Cation exchange chromatography: Sample was diluted in 40ml of 50mM MES-NaOH pH 6.5
(8mS/cm) and applied on 1ml Resource S column. Flow rate 2ml/min. Gradient: 15ml(15CV)
0.05-0.3M NaCl in above buffer. Fractions 0.5ml. Fractions 22-24 were combined, yielded in
1.7mg of total protein
114
SDS-PAGE analysis (4-12% Nu Page Novex BT gel):
1 2 3 4 5 6 7
1. Mark12
2. Heparin 1 flow through
3. 1.8M AS pellet
4. 3.2M AS pellet
5. Heparin 2 unbound
6. After Heparin 2
7. Final prep
Application of AS cut was successful in attempt to purify SfsA without nuclease treatment.
However purity was not as good as for purification with nuclease treatment. In the final
preparation there is significant contamination and purity is not higher than 80%.
Nevertheless crystallisation of the above prep with DNA was successful and structure was
solved.
115
7. Tagged proteins
Proper use of a His-tag: Human protein PARP1 expressed in [Link]
Here is an example of purification of human protein PARP1. The level of expression of this
protein in [Link] cells is extremely low. The rough estimation of expression level comes to about
0.15-0.2% of total protein. No any band can be seen on SDS gel in CFE corresponding to
PARP1. Luckily the protein was His-tagged which allow me to purify it to acceptable purity in
just too steps.
PARP1 (PolyADP-ribose polymerase):
MW =113083,
pI 9.0
The protein has two attractive properties : High MW and basic pI.
Both gel filtration and cation exchange chromatography potentially can produce a good result. It
appeared that protein is dimeric and so gel filtration worked very well.
CFE from 1.5l culture was prepared as a standard procedure (sonication on ice 3x20sec at
16micron → spin down cell debris at 70000g for 10 min) in Buffer A+ 0.5M NaCl
Protein concentration was estimated by Bio-Rad assay.
CFE: V=35ml, C=7.5mg/ml, 260mg
The elution profile revealed a bigger peak in fractions 10 to 12 (normally containing [Link]
proteins with low affinity to Ni ) and small peak in fractions 15 to 18, which presumably
contained His-tagged protein. Protein concentration in fractions was estimated by Bio-Rad
assay.
Fractions 16 -18 were combined: V=9ml, C=0.225mg/ml, 2.2mg
116
To prepare sample for gel filtration the volume was reduced using VivaSpin device with
MWCO 50000:
V=1ml, C=1.85mg/ml, 1.85mg
Gel filtration: Sample was applied on a 16x600 HiLoadSuperdex200 column equilibrated in
Buffer A. Flow rate 1.5ml/min. Fractions (V=2ml ) were collected after void volume.
1 2 3 4 5 6
1. CD
2. CFE
3. Flow through Ni
column
4. GF loaded sample
5. Final preparation
6. Mark12
SAG19 purification
CFE was prepared by a standard protocol (Protocols, 2) in Buffer A (50mM tris-HCl pH 8.0)
Ni-NTA chromatography: CFE was applied on a 5ml HisTrap-HP column. Flow rate
5ml/min. Fractions 3ml. Gradient: 90ml of Imidazole concentration from 0 to 0.35M in
BufferA+0.5M NaCl.
Preparation for cleavage: Sample was concentrated on VivaSpin device with MWCO 30000
and diafiltration cap was used for buffer exchange to cleavage buffer (20mM tris-HCl pH 7.4,
50mM NaCl, 2mM CaCl2). Protein was concentrated to V=1.35ml, C=32.5mg/ml, 43.7mg
Cleavage: Preliminary cleavage experiments revealed that cleavage was not 100% specific, we
always observed additional bands on gel, but best results was when we use protein at high
concentration. Also, opposite to recommended EK : Protein ratio 1U : 20-100µg we used 1U
per 1.5mg of SAG19. Cleavage was performed at room temperature for about 16 hours
(overnight). Reaction was stopped by addition of 10mM of p-APMSF.
118
Purification of SAG19 (IEC): Protein concentration was checked in the sample after cleavage:
C=26mg/ml, V=1.35ml, 35mg
Sample was diluted in 10ml of Buffer A and applied on a 6ml Resource Q column.
Flow rate 5ml/min. Fractions 2.5ml. Gradient:120ml, 0-0.35M NaCl in Buffer A
119
The Mass Spectrometry analysis had shown that the purified protein was shorter than expected,
24565Da instead of 26061. N-terminal sequencing revealed that main component of the prep
starts 15 aa residues later than predicted.
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAA
TKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGT*DDDDK**AMAAAPDFSSALSL
R↓SSTATSQQNSLSTNIFASGDVSPQTPTPPQADEKTEDCLAIINKLRSENLKDLLGTLAKAEDTEVTESLKAIKIEEPASPTAPKIA
VTLAGSNVDTCESGEGANAKKYPGLVIPFPHDTEFNCNALIQATYTAGLDHLKQSNFEPSTGTYDVENAPFNNVNASNVAFLLS
EKSKKVSCAATKDCKAGHDVLFCYFIDPLRKEDKPFTAELYNALWGLEALEHHHHHH
DTNB reaction under denaturing conditions did not revealed any reduced cysteins indicating
that protein was correctly folded. Structure was subserviently determined of the stable core of
the protein which was found to be even shorter (started peptide is shown in green) as further
degradation was observed during crystallisation.
So, this case revealed that specific protease may be not so specific. In case of SAGs EK is not
just was very active to cleave target protein at a number of sites different in structure to the
specific site, but Therodoxin tag, presumably well folded part of the construct seems was
cleaved as well. SAG19 was the best example among the SAGs, a number of other SAGs from
the same organism were destroyed by EK to a bunch of fragments.
In this particular case we had to use this kind of construct to produce specific eukaryotic
proteins containing disulphate bridges, but in vast majority of cases if tag has to be removed it is
better to try to express protein without tag rather than potentially have a trouble with unspecific
cleavage.
120
Cleaver use of tag: TssA from Burkholderia cepacia
TssA is one of the proteins which form Type VI secretion system. It is protein of 41kDa which
forms a big ring-like 32mer. The protein consists of about 30kDa N-terminal domain (NTD), a
long flexible linker and 8.5kDa C-terminal domain (CTD) which involved in oligomerisation.
Attempts to crystallise the whole protein did not succeed most likely due to flexibility of the
linker. NTD was expressed separately and structure was solved. Expression of CTD was 100%
insoluble. The clever move of Dr Mark Thomas was to fuse CTD to MBP (Maltose Binding
Protein) which is close in size to NTD. Linker between MBP and TssA CTD contained a
cleavage site for Factor Xa Protease. This approach works perfectly, huge soluble expression
was achieved and MBP-TssACTD forms oligomers of the same size as a native protein. After
MBP was cleaved off, TssA CTD rings were purified, crystallised and structure was solved.
CFE was applied, unbound material was collected and column was washed with 20ml of the
starting buffer. Unbound material was V=21ml, C=2.2mg/ml, 46mg
Elution was achieved with 10mM maltose in the same buffer. 2-2.5ml fractions were collected
and protein concentration was estimated in them by method of Bradford:
For 2µl:
Fr A595
1 0 Fractions 2-5 were pooled:
2 0.1 V= 9ml, C=2.7mg/ml, 24mg
3 0.51
4 0.5
5 0.22
6 0.08
Amylose column was equilibrated with starting buffer again and unbound material was
reapplied on the column. The reason for doing this was my previous experience that not all MBP
fused protein would be bound to the column. It seems, binding conditions is not optimised.
Also, column is losing some amylose with each use and capacity decreases.
I would recommend doing second application, especially in case if expression level of MBP
fused protein is high.
121
Unbound material after second application: V=21ml, C=1mg/ml, 21mg.
Second set of eluted fractions was analysed for protein:
For 5µl:
Fr A595
1. 0
2. 0.65
3. 0.81 Fr 2-5: V=9.5ml, C=1.5mg/ml, 14.5mg
4. 0.5
5. 0.22
6. 0.1
Eluates from both runs were combined and concentrated using VivaSpin device with MWCO
50000: V=1.6ml, C=14mg/ml, 30mg
Cleavage: The sample was supplemented with CaCl2 (1.6µl of 2M solution) to make it 2mM.
150µl of 1mg/ml (150µg) of Factor Xa Protease (NEB) was added (5µg/1mg of MBP-CTD).
Incubation: overnight at room temperature.
Gel filtration: Sample was applied on a 1.6x60cm gel filtration column which was
Superdex200 in the past, but then it seems dextran moiety was destroyed and pores became
bigger, more like for Superose 6. I use this column when I have to purify big proteins.
Gel filtration was performed in buffer 0.5M NaCl, tris-HCl pH 8.0. Flow rate 1.5ml/min.
Fractions 2ml. Fractions were analysed for protein and by SDS-PAGE.
Apparent MW
250kDa
M12GFl 9 10 11 12 13 15 16 17 18 19 20 21 Fractions
122
As you can see on gel there is small amount of uncleaved protein which can not be separated
from the cleaved TssA CTD because uncleaved molecules forms oligomers alongside of the
cleaved ones. In our early attempts to crystallise TssA rings crystals did not difract well, most
likely due to heterogenity as a result of having one or two uncleaved molecules in the ring.
To fight this problem we introduced Amylose chromotography as a last purification step.
Amylose Chromatography: Sample obtained after gel filtration was diluted twice to reduce
salt concentration and was applied on a Amylose column. 2-2.5ml fractions were collected.
Column was washed with 10ml of starting buffer and then eluted with 10mM maltose in the
same buffer. All fractions were analysed by Bradford.
For 20ul:
Fr A595
1. 0
2. 0
3. 0.11
4. 0.25
5. 0.25
6. 0.24
7. 0.24
8. 0.23
9. 0.18
10. 0.09
11. 0.04
12. 0.05
13. 0.25
14. 0.1
15. 0.04
Unbound material was collected: fractions 3-9: V=19ml, C=0.3mg/ml, 5.7mg
Sample was concentrated, buffer exchanged and used for crystallisation. This time crystals were
better and stucture was solved.
The purification progress was analysed by SDS-PAGE: 4-12% NuPage BT Novex gel
Mark 12 MW
1 2 3 4 56 78
standards 1. Mark12
2. CFE
3. Unbound from second Amylose
chromatography
4. MBP-TssACTD
5. Cleaved sample
6. TssA CTD after gel filtration
7. Final prep
8. Fr 13 from last Amylose chromatography
Summary
As we can see on gel expression level of MBP-TssACTD is extremely high,
may be up to 40-50%. After second Amylose column there still is
significant amount of fused protein in unbound material...Are binding buffer
conditions optimal?
Cleavage on this occasion was not ideal and so sample contained noticeable
amount of uncleaved molecules. Small contamination of MBP also was left
in the prep of CTD rings after gel filtration.
Last amylose chromatography improved purity significantly. Some of the
rings probably containing one or two uncleaved molecules passed through
Amylose column unbound but it seems amount of such molecules was not
significant and crystals were ordered and diffracted well.
123
8. Special cases
Phosphoglycerate Kinase from Escherichia coli
I include this case to show that it is possible to purify protein from the natural source even if it is
not one of the main majors in CFE, but by chance has affinity to Heparin and also separates
nicely from other proteins on Resource Q column.
The story begins when I was asked to purify DNA binding protein called Rv3616c, which has
MW 39888 and pI 5.2. Protein was untagged and expression level was very low so no certain
band could be identified as a target protein. So strategy in this case is clear: Run Heparin
chromatography and find 40kDa protein as one of the significant or at least visible proteins in
eluted fractions. Second step is IEC and then depending on result, HIC+GF or just one of them.
If purification is successful in case like that we must to confirm identity of the protein (usually
by Mass Spectrometry).
Purification
CFE was prepared from about 6g of cells in Buffer A (50mM tris-HCl pH 8.0 ).
CFE: V=24ml, C=13mg/ml, 310mg
Heparin Chromatography. CFE was applied on a 5ml Heparin column.
Flow rate 4ml/min. Fractions 2.5ml. Gradient: 50ml 0-1M NaCl in bufferA.
36kDa
124
Fractions 16+17 were combined: V=5ml, C=1.8mg/ml, 9mg
Anion Exchange Chromatography. Sample was diluted to 5mS/cm and applied on a 1ml
Resource Q column.
Flow rate 2ml/min, fractions 0.5ml.
Gradient: 10ml 0-1M NaCl in bufferA
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 Mark 12 MW
standards
Clear contender
125
Gel filtration. Sample was applied on a Superdex200GL(24ml) column.
Buffer: 0.5M NaCl in bufferA
Flow rate 0.5ml/min
Fractions 0.5ml
Apparent MW
40kDa
1. Mark12
2. CFE
3. After Heparin
4. After IEC
5. After GF (final prep)
Purity is about 80-85%. Yield is 0.5mg from 310mg of total protein. Presuming 30% yield
from three steps purification protocol, PGK expression is about 0.5% of total cell protein.
What to say? PGK is a good protein to purify!
126
Low affinity chromatography: BPSL1958
BPSL1958 is one of proteins which found to be moderately important for the Burkholderia
pseudomallei virulence. When structure was determined it appeared to be sugar binding protein.
Further experiments revealed significant affinity of BPSL1958 to a number of sugars, including
glucose.
MW 36126
pI 4.38
A280 1mg/ml 2.13
For protein with pI 4.38 we expect that it has high affinity to anion exchange matrix. In fact
under our standard conditions of 50mM tris pH 8.0 this protein did not bind to DEAE column
properly and start to pass through the column in the end of sample application. We increase pH
to 9.0, but seems it did not help. In fact it was better interaction at pH 7.0!
So we decided to employ low affinity chromatography protocol.
BPSL1958 purification
CFE was prepared in 30mM tris-HCl buffer pH 7.0 using standard protocol, but with
modifications. The volume of CFE had to be reduced and so cells:buffer ratio was reduced, 3g
of cells were suspended in about 12 ml of buffer. Sonication was extended to 4 cycles of 20 sec
at 16micron amplitude and centrifugation was performed for 20 minutes at 70000g to
compensate for higher viscosity of the sample.
CFE: V=12ml, C=10mg/ml, 120 mg
Anion Exchange chromatography. Sample was applied on a 50ml column with DEAE-
Sepharose Fast Flow (1.6x25cm) equilibrated in the 30mM tris-HCl pH 7.0 at flow rate
5ml/min. 4ml fractions were collected. Column was washed with 75ml of the starting buffer and
then a 50ml gradient of NaCl concentration from 0 to 1M was applied to elute rest of the
proteins.
Fractions were analysed by Bradford (5ul)(presented on chart) and by SDS-PAGE (Laemmly,
12%)
36kDa
127
BPSL1958 is one of those proteins which show low level of Bradford reaction. So figures of
A595 are low and do not really correspond to BPSL1958 distribution. So we would probably need
to run SDS-PAGE every time to find exact fractions with the target protein.
Luckily in this case we can use another quick method as we found that UV spectra are very
informative in this case.
UV spectra(240-340nm) were taken from the fractions 7-15:
As you can see fractions 11 and 12 display protein spectra, fractions 10 shows mix of protein
and nucleic acid while in other fractions nicleic acids are dominated. As we can see on gel
image, fractions 11 and 12 contain most pure BPSL1958.
In subsequent purifications we were taken spectra from relevant fractions to find 2-3 fractions
which show protein spectra and pooled them.
Fr 11+12: V=8ml, C=0.48mg/ml, 3.8mg (Bradford reaction)
Sample was concentrated using VivaSpin: V=1.4ml, C=3mg/ml (BR). Concentration also was
measured by UV (dilution 1:50):
For BPSL1958 A1mg/ml = 2.13
(0.48x50)/2.13= 11.2mg/ml
So Bradford reaction underestimate
BPSL1958 concentration almost 4-fold.
Total protein: 1.4ml x11.2mg/ml= 15.7mg
128
Gel filtration. Sample obtained after concentration was applied on a 1.6x60 HiLoad
Superdex200 column.
Buffer: 0.5M NaCl, 50mM tris-HCl pH 8.0
Flow rate 1.5ml/min
Fractions 2ml
Apparent MW
10kDa
Well, once again BPSL1958 displays unusual behaviour. Apparent MW from gel filtration is
10kDa instead of 36kDa. It seems, interaction with glucose residues in dextran moiety in the
Superdex beads delays its elution from the Superdex column!
Fractions 8-10 were pooled and UVspectrum was taken with 10 fold dilution:
A280=0.31
Mark 12
1 2 3 4 5 Summary
1. Mark12
MW
standards 2. CD BPSL1958 is one of those odd proteins which
3. CFE display unusual behaviour in all possible ways:
4. GF load Having pI 4.4 it does not bind to anion exchanger
5. Final Being 36kDa it runs as 10kDa on gel filtration
prep column
It shows low signal in Bradford reaction
Expression of BPSL1958 was huge, but mainly
insoluble.
Thanks to low affinity chromatography main
purification was achieved on first step.
85-90% pure protein was obtained after 2 step
purification despite of low level of soluble
expression.
129
BacM from Myxococcus Xanthus
BacM is one of the weirdest proteins I ever got to purify. This protein forms filaments of a
different size so to purify protein we had to use urea to destroy them. Previously His-tagged
version of this protein was expressed in [Link] and it was purified by using Ni-column under
denaturing conditions and then urea was dialysed out resulting in BacM forming big aggregates
which came out of solution. Easy enough. But it was not easy for untagged BacM.
BacM : MW 13192, pI 8.2
BacM has no aromatic amino acid residues in its composition, so it displays no A280 absorbance.
Luckily it reacts with Bradford reagent!
Level of expression of BacM in [Link] was relatively low, about 3% or so.
Attempts to use cation exchange chromatography under denaturing conditions as a first step of
purification did not succeed. At pH 5 in 8M Urea BacM has very low affinity to SP-Sepharose. It
mainly passed through the small column in first instance. When I tried to apply a low affinity
chromatography it was bound to the bigger column and eluted in very first fractions of the NaCl
gradient together with a lot of contaminations.
So I attempted to do some separations under native conditions.
When cells were destroyed in 50mM tris pH 8.0 and CFE was prepared using our standard
centrifugation BacM was found in the pellet and in the supernatant. Decreasing speed of
centrifugation to 12000g and time to 5minutes we managed to keep all BacM in supernatant
fraction. We also get lucky with ammonium sulphate cut. All BacM precipitates by 1.5M
ammonium sulphate displaying some purification.
When AS pellet was dissolved in native buffer and run on gel filtration column BacM was mainly
found among particles bigger than 1000kDa, some smaller oligomers and also on monomers-
dimers position:
Mark 12
MW
standards
It was clear that upon this point we have to go under denaturing conditions.
So AS pellet was dissolved in 8M Urea and gel filtered in the presence of 7M Urea. Best
purification was achieved on this stage. However protein still was not pure. Best purity of about
80% or so was only reached after additional negative IEC and second gel filtration as described
below.
130
CFE: V=48ml, C=11mg/ml, 520mg
37ml of 4M AS was added (to 1.7M) , incubated for 5 min on ice and spin down at 43000g for
10min. Supernatant fraction: V=80ml, C=3mg/ml, 240mg
2 pellets were obtained. One of them was placed on -20oC and saved for the next time.
To the second AS pellet 3ml of Buffer U (8M Urea, 50mM HEPES pH 7)was added
Extraction of BacM was performed by stirring the mixture for 1 h at room temperature
Insoluble material was removed by centrifugation at 70000g for 20min
Supernatant fraction: V=3.4ml, C=8.7mg/ml, 32mg
3ml was applied on GF column in buffer U. Flow rate 1.5ml/min, fractions 2ml
131
Fractions were analysed for protein and by SDS-PAGE:
BR 10ul:
Fr A595 M12 L 3 6 7 12 Fractions
2 0.22
3 0.32
4 0.3
5 0.35
6 0.34
7 0.3
8 0.04
10 0.0
11 0.04
12 1.2
13 0.24
14 0.04
132
Fr 8-10 were combined:
V=1.5ml, C=0.33mg/ml, 0.5mg Final preparation
SDS-PAGE:
1 2 34 1. Mark12
2. Before last GF
3. Final prep
4. Second Urea extraction
Summary
Unfortunately for this purification I have not run gel to show purification progress, so below is a
combination of different gels:
1 2 3 4 5 6 7 8 9 10 Mark 12 MW
standards
1. Mark12
2. CD
3. CFE
4. AS supernatant
5. AS pellet
6. Urea pellet
7. Urea extract
8. After first GF
9. After negative IEC
10. After second GF
(final preparation)
GroES
Looking on gel for Urea extract we would estimate BacM to be about 10% or so, so having
32mg on this stage, we would expect to have about 1mg of pure protein after 3 step purification.
However, BacM kept disappearing even when left in an eppendorf in the presence of Urea.
Almost half of the protein was lost on VivaSpin device, presumably stick to a membrane. Only
0.5mg of the protein was obtained, very low yield with purity not better than 80%.
Also it seems significant amount of BacM was left in the pellet after Urea extraction. Second
extraction was attempted but extract was much less enriched in BacM than the first extract and
so it was dismissed.
Another unpleasant thing was that BacM co-purifies with another a bit smaller protein. It was
identified as GroES!!!?
So, I cannot say that purification of BacM was a great success.
However, I have managed to optimise purification by using the same buffer (Buffer U) for all
purification steps and achieved more or less acceptable purity. In this case, with very limited
options for chromatography, purity completely depends on level of TP expression.
133
Perfect purity:
Imidazoleglycerol-phosphate dehydratase 1 from Arabidopsis thaliana
IGPD takes part in histidine biosynthesis in plants and bacteria. It is a homooligomer of 24
subunits of about 22-29kDa . Enzyme contains Mn important for its activity. There are two
types of IGPD and Arabidopsis thaliana has both type 1 and type 2. Type 1 24mer dissociates
to stable trimers when Mn is removed in the presence of EDTA and associates to 24mer when
Mn is bound back.
Type 2 IGPD keeps its oligomeric 24mer form in the presence of EDTA and absence of Mn.
Thanks to such an unique property Type 1 IGPD could be purify to perfect 100% purity by
employing two gel filtrations: first gel filtration is performed in the presence of EDTA, trimers
are collected and then sample is supplied with Mn and subjected to gel filtration in the presence
of Mn to obtain 100% pure 24mer.
Type 1 IGPD from [Link] purification
CFE was prepared from 4g of cells in buffer A ( 40mM tris-HCl pH 8.0, 2mM EDTA) using a
standard protocol.
CFE: V=28ml, C=9mg/ml, total protein 252mg
Anion exchange chromatography
Sample was applied on a 20ml DEAE Sepharose FF column at flow rate about 4.5ml/min.
Chromatography was performed using peristaltic pump, UV monitor UV-1 Pharmacia and 2110
Bio-Rad fraction collector (see page 15). Elution was performed with 300ml of gradient NaCl
concentration from 0 to 0.5M in buffer A. 7.5ml fractions were collected.
22ml of 4M ammonium sulphate solution was added to the sample obtained after IEC and so
IGPD was precipitated by 1.5M AS. Pellets were collected by centrifugation (5minutes at
45000g) and dissolved in 1 ml of buffer A: V=1.35ml, C=23mg/ml, 32mg.
First gel filtration
Gel filtration was performed on HiLoad Superdex200 column in buffer A+0.1M NaCl at flow
rate 1ml/min. 2m fractions were collected after void volume.
134
Fractions were analysed for
protein and four fractions
with highest protein
concentration were collected:
Fr 13-16: V=8ml,
C=2.5mg/ml,
Total 20mg
Volume of the sample was
reduced using VivaSpin
30000MWCO device:
V=0.6ml, C=29mg/ml,
17.5mg
1. Mark12
2. CFE
3. After AEC
4. Sample for the first GF
5. Sample for the second GF
6. Final preparation
135
FEN
BFL1
GDH
IGPD
RuvA
NheA FrmR
SfsA
RuvC
LrpC
136